Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
Location | 39908..40711 | Replicon | plasmid P2 |
Accession | NZ_OW968419 | ||
Organism | Enterobacter cloacae isolate 764 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A7W3E3C9 |
Locus tag | LQ125_RS24300 | Protein ID | WP_022652313.1 |
Coordinates | 40181..40711 (+) | Length | 177 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | W8E6Q5 |
Locus tag | LQ125_RS24295 | Protein ID | WP_022652312.1 |
Coordinates | 39908..40177 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ125_RS24275 (AI3013V2_4710) | 35665..36633 | + | 969 | WP_000654812.1 | IS5-like element IS903B family transposase | - |
LQ125_RS24280 | 36754..36822 | + | 69 | Protein_44 | serine/threonine protein kinase | - |
LQ125_RS24285 (AI3013V2_4711) | 36997..37737 | + | 741 | WP_022652310.1 | site-specific integrase | - |
LQ125_RS24290 (AI3013V2_4712) | 38063..39052 | - | 990 | WP_022652311.1 | RepB family plasmid replication initiator protein | - |
LQ125_RS24295 (AI3013V2_4713) | 39908..40177 | + | 270 | WP_022652312.1 | DUF1778 domain-containing protein | Antitoxin |
LQ125_RS24300 (AI3013V2_4714) | 40181..40711 | + | 531 | WP_022652313.1 | GNAT family N-acetyltransferase | Toxin |
LQ125_RS24305 (AI3013V2_REPA000000083) | 40817..41514 | + | 698 | WP_095033700.1 | IS1-like element IS1B family transposase | - |
LQ125_RS24310 | 41537..41935 | - | 399 | Protein_50 | cytoplasmic protein | - |
LQ125_RS24315 | 41934..42482 | + | 549 | Protein_51 | hypothetical protein | - |
LQ125_RS24320 | 42678..42932 | - | 255 | Protein_52 | hypothetical protein | - |
LQ125_RS24325 | 42850..43329 | + | 480 | WP_229694441.1 | 3'-5' exonuclease | - |
LQ125_RS24330 (AI3013V2_4721) | 43382..43777 | + | 396 | WP_040219261.1 | hypothetical protein | - |
LQ125_RS24335 (AI3013V2_4722) | 43774..44385 | + | 612 | WP_015493086.1 | DUF2913 family protein | - |
LQ125_RS24340 (AI3013V2_4723) | 44382..45332 | - | 951 | WP_040219234.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
LQ125_RS24345 | 45479..45679 | - | 201 | WP_040219232.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sul1 / qacE / aadA2 | mrkJ / mrkF / mrkD / mrkC / mrkB / mrkA | 1..196573 | 196573 | |
- | inside | IScluster/Tn | - | - | 35665..41514 | 5849 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20349.26 Da Isoelectric Point: 6.7496
>T296126 WP_022652313.1 NZ_OW968419:40181-40711 [Enterobacter cloacae]
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
MEGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYVLVTRENKPRVMGYYTLSGSCFEKILLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENCNSL
FYPTKSIEELFEVNDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7W3E3C9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Z3XDS5 |