Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 223245..223771 | Replicon | plasmid P1 |
Accession | NZ_OW968418 | ||
Organism | Enterobacter cloacae isolate 764 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | LQ125_RS23730 | Protein ID | WP_000323025.1 |
Coordinates | 223245..223532 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | LQ125_RS23735 | Protein ID | WP_000534858.1 |
Coordinates | 223532..223771 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ125_RS23700 | 218815..218991 | - | 177 | WP_001371930.1 | hypothetical protein | - |
LQ125_RS23705 (AI3013V2_4596) | 219502..220446 | + | 945 | WP_000778029.1 | DUF5417 domain-containing protein | - |
LQ125_RS23710 (AI3013V2_4597) | 220542..221144 | + | 603 | WP_001371889.1 | hypothetical protein | - |
LQ125_RS23715 (AI3013V2_4598) | 221204..221554 | + | 351 | WP_000743059.1 | hypothetical protein | - |
LQ125_RS23720 (AI3013V2_4600) | 222086..222406 | + | 321 | WP_000332796.1 | hypothetical protein | - |
LQ125_RS23725 (AI3013V2_4601) | 223019..223144 | - | 126 | WP_229020258.1 | DUF5431 family protein | - |
LQ125_RS23730 (AI3013V2_4602) | 223245..223532 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
LQ125_RS23735 (AI3013V2_4603) | 223532..223771 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
LQ125_RS23740 | 223796..223900 | + | 105 | Protein_231 | protein YdfV | - |
LQ125_RS23745 (AI3013V2_4604) | 224034..224957 | - | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
LQ125_RS23750 (AI3013V2_4605) | 225157..225729 | - | 573 | WP_001515348.1 | cytochrome b/b6 domain-containing protein | - |
LQ125_RS23755 (AI3013V2_4606) | 226205..227443 | - | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | ant(2'')-Ia / aadA2 / qacE / sul1 / qnrA1 / tet(A) / blaVIM-1 / dfrB1 / ant(3'')-Ia / aac(6')-Ib-cr / blaOXA-1 / catB3 / ARR-3 / blaCTX-M-9 / mcr-9 | - | 1..281280 | 281280 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T296125 WP_000323025.1 NZ_OW968418:c223532-223245 [Enterobacter cloacae]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|