Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4609717..4610333 | Replicon | chromosome |
Accession | NZ_OW968417 | ||
Organism | Enterobacter cloacae isolate 764 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LQ125_RS22190 | Protein ID | WP_080339264.1 |
Coordinates | 4609717..4610088 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A9E7BIL4 |
Locus tag | LQ125_RS22195 | Protein ID | WP_023298920.1 |
Coordinates | 4610091..4610333 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ125_RS22175 (AI3013V2_4296) | 4607217..4608119 | + | 903 | WP_003861960.1 | formate dehydrogenase subunit beta | - |
LQ125_RS22180 (AI3013V2_4297) | 4608116..4608751 | + | 636 | WP_006808711.1 | formate dehydrogenase cytochrome b556 subunit | - |
LQ125_RS22185 (AI3013V2_4298) | 4608748..4609677 | + | 930 | WP_022649835.1 | formate dehydrogenase accessory protein FdhE | - |
LQ125_RS22190 (AI3013V2_4299) | 4609717..4610088 | - | 372 | WP_080339264.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ125_RS22195 (AI3013V2_4300) | 4610091..4610333 | - | 243 | WP_023298920.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
LQ125_RS22200 (AI3013V2_4301) | 4610533..4611453 | + | 921 | WP_163346823.1 | alpha/beta hydrolase | - |
LQ125_RS22205 (AI3013V2_4302) | 4611462..4612403 | - | 942 | WP_022649838.1 | fatty acid biosynthesis protein FabY | - |
LQ125_RS22210 (AI3013V2_4303) | 4612448..4612885 | - | 438 | WP_063150747.1 | D-aminoacyl-tRNA deacylase | - |
LQ125_RS22215 (AI3013V2_4304) | 4612882..4613763 | - | 882 | WP_023298923.1 | virulence factor BrkB family protein | - |
LQ125_RS22220 (AI3013V2_4305) | 4613757..4614356 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
LQ125_RS22225 (AI3013V2_4306) | 4614475..4615275 | - | 801 | WP_023298924.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13596.66 Da Isoelectric Point: 6.4866
>T296123 WP_080339264.1 NZ_OW968417:c4610088-4609717 [Enterobacter cloacae]
MEHMAVFDTNILIDLFNNHVEAADAIDRTASHRAISLITWMEVMVGARRHGQEAKTAAVMGAFEIIDITREIAERSVLLR
EQHGMKLPDAIILATAQSRSCPLISRNTKDFSGIAGVVSPYHL
MEHMAVFDTNILIDLFNNHVEAADAIDRTASHRAISLITWMEVMVGARRHGQEAKTAAVMGAFEIIDITREIAERSVLLR
EQHGMKLPDAIILATAQSRSCPLISRNTKDFSGIAGVVSPYHL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|