Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3743962..3744619 | Replicon | chromosome |
| Accession | NZ_OW968417 | ||
| Organism | Enterobacter cloacae isolate 764 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0A6GSQ9 |
| Locus tag | LQ125_RS18090 | Protein ID | WP_022649305.1 |
| Coordinates | 3743962..3744372 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | LQ125_RS18095 | Protein ID | WP_003863437.1 |
| Coordinates | 3744353..3744619 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ125_RS18070 (AI3013V2_3496) | 3739960..3741693 | - | 1734 | WP_163347529.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LQ125_RS18075 (AI3013V2_3497) | 3741699..3742412 | - | 714 | WP_022649304.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ125_RS18080 (AI3013V2_3498) | 3742441..3743337 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| LQ125_RS18085 (AI3013V2_3499) | 3743439..3743960 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| LQ125_RS18090 (AI3013V2_3500) | 3743962..3744372 | - | 411 | WP_022649305.1 | protein YgfX | Toxin |
| LQ125_RS18095 (AI3013V2_3501) | 3744353..3744619 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| LQ125_RS18100 (AI3013V2_3502) | 3744914..3745894 | + | 981 | WP_063854323.1 | tRNA-modifying protein YgfZ | - |
| LQ125_RS18105 (AI3013V2_3503) | 3746415..3747074 | - | 660 | WP_022649307.1 | hemolysin III family protein | - |
| LQ125_RS18110 (AI3013V2_3504) | 3747341..3748072 | + | 732 | WP_022649308.1 | MurR/RpiR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T296122 WP_022649305.1 NZ_OW968417:c3744372-3743962 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAMVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMIGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A6GSQ9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |