Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2281257..2281996 | Replicon | chromosome |
Accession | NZ_OW968417 | ||
Organism | Enterobacter cloacae isolate 764 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | - |
Locus tag | LQ125_RS11080 | Protein ID | WP_163347044.1 |
Coordinates | 2281257..2281742 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | LQ125_RS11085 | Protein ID | WP_003857131.1 |
Coordinates | 2281730..2281996 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ125_RS11045 (AI3013V2_2143) | 2276282..2277040 | - | 759 | WP_032624253.1 | trans-aconitate 2-methyltransferase | - |
LQ125_RS11050 (AI3013V2_2144) | 2277125..2277709 | - | 585 | WP_058676643.1 | NUDIX domain-containing protein | - |
LQ125_RS11055 (AI3013V2_2145) | 2277796..2278554 | + | 759 | WP_163347047.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
LQ125_RS11060 (AI3013V2_2146) | 2278659..2279951 | + | 1293 | WP_163347045.1 | glycosyl hydrolase family 28 protein | - |
LQ125_RS11065 (AI3013V2_2147) | 2280278..2280523 | - | 246 | WP_163347006.1 | hypothetical protein | - |
LQ125_RS11070 (AI3013V2_2148) | 2280657..2280830 | + | 174 | WP_234035923.1 | hypothetical protein | - |
LQ125_RS11075 (AI3013V2_2149) | 2280827..2281231 | + | 405 | WP_234035924.1 | hypothetical protein | - |
LQ125_RS11080 (AI3013V2_2150) | 2281257..2281742 | - | 486 | WP_163347044.1 | GNAT family N-acetyltransferase | Toxin |
LQ125_RS11085 (AI3013V2_2151) | 2281730..2281996 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
LQ125_RS11090 (AI3013V2_2152) | 2282060..2282989 | - | 930 | WP_163347042.1 | LysR family transcriptional regulator | - |
LQ125_RS11095 (AI3013V2_2153) | 2283119..2284507 | + | 1389 | WP_163347040.1 | MFS transporter | - |
LQ125_RS11100 (AI3013V2_2154) | 2284486..2285043 | - | 558 | WP_023300131.1 | OmpH family outer membrane protein | - |
LQ125_RS11105 (AI3013V2_2155) | 2285164..2286300 | - | 1137 | WP_023300132.1 | type 1 fimbrial protein | - |
LQ125_RS11110 (AI3013V2_2156) | 2286324..2286902 | - | 579 | WP_022648146.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2266554..2281996 | 15442 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17500.15 Da Isoelectric Point: 9.6275
>T296117 WP_163347044.1 NZ_OW968417:c2281742-2281257 [Enterobacter cloacae]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNI
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGNLRRNI
PDPIPVIILARLAVDVSIRGNGLGADLLQDAVLRCYRVAENIGVRAIMVHALTEDAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|