Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1076283..1076904 | Replicon | chromosome |
Accession | NZ_OW968417 | ||
Organism | Enterobacter cloacae isolate 764 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A837FFM2 |
Locus tag | LQ125_RS05170 | Protein ID | WP_015571250.1 |
Coordinates | 1076283..1076501 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | F5RUW7 |
Locus tag | LQ125_RS05175 | Protein ID | WP_006809850.1 |
Coordinates | 1076530..1076904 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ125_RS05140 (AI3013V2_0998) | 1072296..1072556 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
LQ125_RS05145 (AI3013V2_0999) | 1072559..1072699 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
LQ125_RS05150 (AI3013V2_1000) | 1072696..1073406 | - | 711 | WP_163346922.1 | GNAT family protein | - |
LQ125_RS05155 (AI3013V2_1001) | 1073509..1074969 | + | 1461 | WP_163346924.1 | PLP-dependent aminotransferase family protein | - |
LQ125_RS05160 (AI3013V2_1002) | 1074941..1075408 | - | 468 | WP_022647269.1 | YlaC family protein | - |
LQ125_RS05165 (AI3013V2_1003) | 1075525..1076076 | - | 552 | WP_022647270.1 | maltose O-acetyltransferase | - |
LQ125_RS05170 (AI3013V2_1004) | 1076283..1076501 | - | 219 | WP_015571250.1 | HHA domain-containing protein | Toxin |
LQ125_RS05175 (AI3013V2_1005) | 1076530..1076904 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
LQ125_RS05180 (AI3013V2_1006) | 1077414..1080560 | - | 3147 | WP_023299464.1 | multidrug efflux RND transporter permease subunit AcrB | - |
LQ125_RS05185 (AI3013V2_1007) | 1080583..1081776 | - | 1194 | WP_022647272.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T296116 WP_015571250.1 NZ_OW968417:c1076501-1076283 [Enterobacter cloacae]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT296116 WP_006809850.1 NZ_OW968417:c1076904-1076530 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FFM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FGN8 |