Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 939755..940470 | Replicon | chromosome |
Accession | NZ_OW968417 | ||
Organism | Enterobacter cloacae isolate 764 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | A0A8I0UM05 |
Locus tag | LQ125_RS04530 | Protein ID | WP_023303149.1 |
Coordinates | 940102..940470 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | A0A8I0UJV2 |
Locus tag | LQ125_RS04525 | Protein ID | WP_023303148.1 |
Coordinates | 939755..940081 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ125_RS04500 (AI3013V2_0868) | 934789..936054 | + | 1266 | WP_045324920.1 | hypothetical protein | - |
LQ125_RS04505 (AI3013V2_0869) | 936363..936797 | + | 435 | WP_023303144.1 | hypothetical protein | - |
LQ125_RS04510 (AI3013V2_0870) | 936856..937695 | + | 840 | WP_023303145.1 | hypothetical protein | - |
LQ125_RS04515 (AI3013V2_0872) | 938385..939206 | + | 822 | WP_023303146.1 | DUF932 domain-containing protein | - |
LQ125_RS04520 (AI3013V2_0873) | 939272..939742 | + | 471 | WP_023303147.1 | DNA repair protein RadC | - |
LQ125_RS04525 (AI3013V2_0874) | 939755..940081 | + | 327 | WP_023303148.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
LQ125_RS04530 (AI3013V2_0875) | 940102..940470 | + | 369 | WP_023303149.1 | TA system toxin CbtA family protein | Toxin |
LQ125_RS04535 (AI3013V2_0876) | 941250..942164 | - | 915 | WP_045308930.1 | hypothetical protein | - |
LQ125_RS04540 (AI3013V2_0877) | 942726..943019 | - | 294 | WP_163347504.1 | hypothetical protein | - |
LQ125_RS04545 (AI3013V2_0879) | 943916..944116 | + | 201 | WP_045308928.1 | hypothetical protein | - |
LQ125_RS04550 (AI3013V2_0880) | 944140..944748 | - | 609 | WP_131631787.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 918837..950872 | 32035 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13727.91 Da Isoelectric Point: 8.2822
>T296115 WP_023303149.1 NZ_OW968417:940102-940470 [Enterobacter cloacae]
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
MKNLPATISRAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGIILADAVNFLVDKYELVRIDRRGF
SSQGQVPYLTVTDILHARRACGLMKSCSYREVSNIVLSHSRQ
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|