Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 59597..60240 | Replicon | plasmid P1 |
| Accession | NZ_OW968348 | ||
| Organism | Klebsiella oxytoca isolate 101 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | LQ183_RS28330 | Protein ID | WP_001044770.1 |
| Coordinates | 59824..60240 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | LQ183_RS28325 | Protein ID | WP_001261282.1 |
| Coordinates | 59597..59827 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ183_RS28290 (AI2945V1_5517) | 55169..56035 | - | 867 | WP_004118283.1 | replication initiation protein | - |
| LQ183_RS28295 | 56570..56674 | + | 105 | WP_032409716.1 | hypothetical protein | - |
| LQ183_RS28300 (AI2945V1_5518) | 56803..57060 | + | 258 | WP_000764642.1 | hypothetical protein | - |
| LQ183_RS28305 (AI2945V1_5519) | 57118..57894 | - | 777 | WP_000015958.1 | site-specific integrase | - |
| LQ183_RS28310 (AI2945V1_5520) | 57891..58634 | - | 744 | WP_000129823.1 | hypothetical protein | - |
| LQ183_RS28315 (AI2945V1_5521) | 58685..59035 | - | 351 | WP_000493378.1 | hypothetical protein | - |
| LQ183_RS28320 | 59179..59640 | - | 462 | WP_072202616.1 | hypothetical protein | - |
| LQ183_RS28325 (AI2945V1_5522) | 59597..59827 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| LQ183_RS28330 (AI2945V1_5523) | 59824..60240 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ183_RS28335 (AI2945V1_5524) | 60314..60532 | + | 219 | Protein_86 | AAA family ATPase | - |
| LQ183_RS28340 (AI2945V1_5525) | 60597..61301 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LQ183_RS28345 (AI2945V1_5526) | 61355..62452 | + | 1098 | Protein_88 | IS66 family transposase | - |
| LQ183_RS28350 (AI2945V1_5527) | 62703..63266 | - | 564 | WP_001097412.1 | chlorite dismutase family protein | - |
| LQ183_RS28355 | 63290..63664 | - | 375 | WP_001348195.1 | cupin domain-containing protein | - |
| LQ183_RS28360 | 63854..64103 | - | 250 | Protein_91 | transposase | - |
| LQ183_RS28365 (AI2945V1_5529) | 64166..64870 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LQ183_RS28370 | 64956..65111 | + | 156 | WP_230138260.1 | DNA sulfur modification protein DndB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-48 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr | - | 1..98209 | 98209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T296114 WP_001044770.1 NZ_OW968348:59824-60240 [Klebsiella oxytoca]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |