Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 59597..60240 Replicon plasmid P1
Accession NZ_OW968348
Organism Klebsiella oxytoca isolate 101

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag LQ183_RS28330 Protein ID WP_001044770.1
Coordinates 59824..60240 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag LQ183_RS28325 Protein ID WP_001261282.1
Coordinates 59597..59827 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ183_RS28290 (AI2945V1_5517) 55169..56035 - 867 WP_004118283.1 replication initiation protein -
LQ183_RS28295 56570..56674 + 105 WP_032409716.1 hypothetical protein -
LQ183_RS28300 (AI2945V1_5518) 56803..57060 + 258 WP_000764642.1 hypothetical protein -
LQ183_RS28305 (AI2945V1_5519) 57118..57894 - 777 WP_000015958.1 site-specific integrase -
LQ183_RS28310 (AI2945V1_5520) 57891..58634 - 744 WP_000129823.1 hypothetical protein -
LQ183_RS28315 (AI2945V1_5521) 58685..59035 - 351 WP_000493378.1 hypothetical protein -
LQ183_RS28320 59179..59640 - 462 WP_072202616.1 hypothetical protein -
LQ183_RS28325 (AI2945V1_5522) 59597..59827 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
LQ183_RS28330 (AI2945V1_5523) 59824..60240 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ183_RS28335 (AI2945V1_5524) 60314..60532 + 219 Protein_86 AAA family ATPase -
LQ183_RS28340 (AI2945V1_5525) 60597..61301 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
LQ183_RS28345 (AI2945V1_5526) 61355..62452 + 1098 Protein_88 IS66 family transposase -
LQ183_RS28350 (AI2945V1_5527) 62703..63266 - 564 WP_001097412.1 chlorite dismutase family protein -
LQ183_RS28355 63290..63664 - 375 WP_001348195.1 cupin domain-containing protein -
LQ183_RS28360 63854..64103 - 250 Protein_91 transposase -
LQ183_RS28365 (AI2945V1_5529) 64166..64870 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
LQ183_RS28370 64956..65111 + 156 WP_230138260.1 DNA sulfur modification protein DndB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaOXA-48 / blaTEM-1A / blaOXA-9 / ant(3'')-Ia / aac(6')-Ib / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr - 1..98209 98209


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T296114 WP_001044770.1 NZ_OW968348:59824-60240 [Klebsiella oxytoca]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT296114 WP_001261282.1 NZ_OW968348:59597-59827 [Klebsiella oxytoca]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References