Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 864797..865454 | Replicon | chromosome |
| Accession | NZ_OW968347 | ||
| Organism | Klebsiella oxytoca isolate 101 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A181X6I0 |
| Locus tag | LQ183_RS04165 | Protein ID | WP_004105559.1 |
| Coordinates | 865044..865454 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A285B945 |
| Locus tag | LQ183_RS04160 | Protein ID | WP_004105561.1 |
| Coordinates | 864797..865063 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ183_RS04135 (AI2945V1_0810) | 859976..861409 | - | 1434 | WP_126489546.1 | 6-phospho-beta-glucosidase | - |
| LQ183_RS04140 (AI2945V1_0811) | 861530..862258 | - | 729 | WP_064352017.1 | MurR/RpiR family transcriptional regulator | - |
| LQ183_RS04145 (AI2945V1_0812) | 862309..862620 | + | 312 | WP_126489545.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ183_RS04150 (AI2945V1_0813) | 862782..863441 | + | 660 | WP_064344096.1 | hemolysin III family protein | - |
| LQ183_RS04155 (AI2945V1_0814) | 863570..864553 | - | 984 | WP_004115279.1 | tRNA-modifying protein YgfZ | - |
| LQ183_RS04160 (AI2945V1_0816) | 864797..865063 | + | 267 | WP_004105561.1 | FAD assembly factor SdhE | Antitoxin |
| LQ183_RS04165 (AI2945V1_0817) | 865044..865454 | + | 411 | WP_004105559.1 | protein YgfX | Toxin |
| LQ183_RS04170 (AI2945V1_0818) | 865463..865984 | - | 522 | WP_004105557.1 | flavodoxin FldB | - |
| LQ183_RS04175 (AI2945V1_0819) | 866106..867002 | + | 897 | WP_004105555.1 | site-specific tyrosine recombinase XerD | - |
| LQ183_RS04180 (AI2945V1_0820) | 867025..867738 | + | 714 | WP_004105554.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ183_RS04185 (AI2945V1_0821) | 867744..869477 | + | 1734 | WP_004105553.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16061.83 Da Isoelectric Point: 10.9455
>T296106 WP_004105559.1 NZ_OW968347:865044-865454 [Klebsiella oxytoca]
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
VVLWQSDLRISWRAQWFSLLMHGVVAALVLVLPWPLSYTPLWLILLSLVVFDCVRSQRRIHARQGEIKLLIDSRLRWQKA
EWDIVGTPWVINSGMLLRLRNTENQRTQHLWVAADSMDAGEWRDLRRLVLQKPTQD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A181X6I0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A285B945 |