Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4814416..4815032 | Replicon | chromosome |
| Accession | NZ_OW968328 | ||
| Organism | Enterobacter cloacae isolate 1382 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LQ108_RS22865 | Protein ID | WP_230137126.1 |
| Coordinates | 4814416..4814787 (-) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | LQ108_RS22870 | Protein ID | WP_046889539.1 |
| Coordinates | 4814790..4815032 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ108_RS22850 (AI2999V1_4436) | 4811916..4812818 | + | 903 | WP_014833793.1 | formate dehydrogenase subunit beta | - |
| LQ108_RS22855 (AI2999V1_4437) | 4812815..4813450 | + | 636 | WP_023622447.1 | formate dehydrogenase cytochrome b556 subunit | - |
| LQ108_RS22860 (AI2999V1_4438) | 4813447..4814376 | + | 930 | WP_029882351.1 | formate dehydrogenase accessory protein FdhE | - |
| LQ108_RS22865 (AI2999V1_4439) | 4814416..4814787 | - | 372 | WP_230137126.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ108_RS22870 (AI2999V1_4440) | 4814790..4815032 | - | 243 | WP_046889539.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| LQ108_RS22875 (AI2999V1_4441) | 4815232..4816149 | + | 918 | WP_230137128.1 | alpha/beta hydrolase | - |
| LQ108_RS22880 (AI2999V1_4442) | 4816162..4817103 | - | 942 | WP_013099362.1 | fatty acid biosynthesis protein FabY | - |
| LQ108_RS22885 (AI2999V1_4443) | 4817148..4817585 | - | 438 | WP_013099363.1 | D-aminoacyl-tRNA deacylase | - |
| LQ108_RS22890 (AI2999V1_4444) | 4817582..4818463 | - | 882 | WP_013099364.1 | virulence factor BrkB family protein | - |
| LQ108_RS22895 (AI2999V1_4445) | 4818457..4819056 | - | 600 | WP_139937197.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13627.72 Da Isoelectric Point: 6.6407
>T296101 WP_230137126.1 NZ_OW968328:c4814787-4814416 [Enterobacter cloacae]
MNNMAVFDTNILIDLFNNRVEAADAIDHAASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEVIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVVTPYQL
MNNMAVFDTNILIDLFNNRVEAADAIDHAASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEVIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVVTPYQL
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|