Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4021589..4022370 | Replicon | chromosome |
Accession | NZ_OW968328 | ||
Organism | Enterobacter cloacae isolate 1382 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | - |
Locus tag | LQ108_RS19115 | Protein ID | WP_230136712.1 |
Coordinates | 4021589..4022080 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | A0A5E1AUV7 |
Locus tag | LQ108_RS19120 | Protein ID | WP_029882966.1 |
Coordinates | 4022077..4022370 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ108_RS19095 (AI2999V1_3712) | 4017329..4018021 | + | 693 | WP_013098687.1 | response regulator | - |
LQ108_RS19100 (AI2999V1_3713) | 4018120..4020255 | - | 2136 | WP_023621449.1 | ornithine decarboxylase | - |
LQ108_RS19105 (AI2999V1_3714) | 4020438..4021151 | + | 714 | WP_013098689.1 | DUF554 domain-containing protein | - |
LQ108_RS19115 (AI2999V1_3715) | 4021589..4022080 | - | 492 | WP_230136712.1 | GNAT family N-acetyltransferase | Toxin |
LQ108_RS19120 (AI2999V1_3716) | 4022077..4022370 | - | 294 | WP_029882966.1 | DUF1778 domain-containing protein | Antitoxin |
LQ108_RS19125 (AI2999V1_3717) | 4022619..4024406 | - | 1788 | WP_219247822.1 | hybrid sensor histidine kinase/response regulator | - |
LQ108_RS19130 (AI2999V1_3718) | 4024403..4025035 | - | 633 | WP_013098693.1 | response regulator transcription factor | - |
LQ108_RS19135 (AI2999V1_3719) | 4025211..4025525 | + | 315 | WP_013098694.1 | lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17628.58 Da Isoelectric Point: 8.1484
>T296100 WP_230136712.1 NZ_OW968328:c4022080-4021589 [Enterobacter cloacae]
MISAPKPLHAGHILTPFCCGVDSMDNWLKQRAMKNQVSGASRTFVCCGNDSNVLAYYSLASSAVMTNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMILMVTLGDLM
ASI
MISAPKPLHAGHILTPFCCGVDSMDNWLKQRAMKNQVSGASRTFVCCGNDSNVLAYYSLASSAVMTNTAPGRFRRNMPDP
IPVVVLGRLAVDQSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYLRVGFEPSPMDPMILMVTLGDLM
ASI
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|