Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3940866..3941526 | Replicon | chromosome |
| Accession | NZ_OW968328 | ||
| Organism | Enterobacter cloacae isolate 1382 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | LQ108_RS18705 | Protein ID | WP_230136681.1 |
| Coordinates | 3940866..3941279 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A5E1AG01 |
| Locus tag | LQ108_RS18710 | Protein ID | WP_013098615.1 |
| Coordinates | 3941260..3941526 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ108_RS18685 (AI2999V1_3631) | 3936859..3938592 | - | 1734 | WP_108453881.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LQ108_RS18690 (AI2999V1_3632) | 3938598..3939311 | - | 714 | WP_013098611.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ108_RS18695 (AI2999V1_3633) | 3939340..3940236 | - | 897 | WP_013098612.1 | site-specific tyrosine recombinase XerD | - |
| LQ108_RS18700 (AI2999V1_3634) | 3940338..3940859 | + | 522 | WP_013098613.1 | flavodoxin FldB | - |
| LQ108_RS18705 (AI2999V1_3635) | 3940866..3941279 | - | 414 | WP_230136681.1 | protein YgfX | Toxin |
| LQ108_RS18710 (AI2999V1_3636) | 3941260..3941526 | - | 267 | WP_013098615.1 | FAD assembly factor SdhE | Antitoxin |
| LQ108_RS18715 (AI2999V1_3637) | 3941821..3942801 | + | 981 | WP_023620448.1 | tRNA-modifying protein YgfZ | - |
| LQ108_RS18720 (AI2999V1_3638) | 3942911..3943570 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| LQ108_RS18725 (AI2999V1_3640) | 3943836..3944567 | + | 732 | WP_020687085.1 | MurR/RpiR family transcriptional regulator | - |
| LQ108_RS18730 (AI2999V1_3641) | 3944684..3946117 | + | 1434 | WP_230136683.1 | 6-phospho-beta-glucosidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16278.21 Da Isoelectric Point: 10.1988
>T296099 WP_230136681.1 NZ_OW968328:c3941279-3940866 [Enterobacter cloacae]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGQ
EWDILGMPWMLSSGMMLRLRQVDGGKCQHLWLAADSMDIAEWRELRRMLLQQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGQ
EWDILGMPWMLSSGMMLRLRQVDGGKCQHLWLAADSMDIAEWRELRRMLLQQQPTQE
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|