Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1066524..1067144 | Replicon | chromosome |
| Accession | NZ_OW968328 | ||
| Organism | Enterobacter cloacae isolate 1382 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A5E1A1U8 |
| Locus tag | LQ108_RS05020 | Protein ID | WP_013095889.1 |
| Coordinates | 1066524..1066742 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | LQ108_RS05025 | Protein ID | WP_008499288.1 |
| Coordinates | 1066770..1067144 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ108_RS04990 (AI2999V1_0970) | 1062536..1062796 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
| LQ108_RS04995 | 1062799..1062939 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQ108_RS05000 (AI2999V1_0971) | 1062936..1063646 | - | 711 | WP_230134442.1 | GNAT family protein | - |
| LQ108_RS05005 (AI2999V1_0972) | 1063748..1065208 | + | 1461 | WP_230134445.1 | PLP-dependent aminotransferase family protein | - |
| LQ108_RS05010 (AI2999V1_0973) | 1065180..1065647 | - | 468 | WP_013095887.1 | YlaC family protein | - |
| LQ108_RS05015 (AI2999V1_0974) | 1065763..1066314 | - | 552 | WP_013095888.1 | maltose O-acetyltransferase | - |
| LQ108_RS05020 (AI2999V1_0975) | 1066524..1066742 | - | 219 | WP_013095889.1 | HHA domain-containing protein | Toxin |
| LQ108_RS05025 (AI2999V1_0976) | 1066770..1067144 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ108_RS05030 (AI2999V1_0977) | 1067657..1070803 | - | 3147 | WP_013095890.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQ108_RS05035 (AI2999V1_0978) | 1070826..1072019 | - | 1194 | WP_023620093.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8625.98 Da Isoelectric Point: 8.9008
>T296092 WP_013095889.1 NZ_OW968328:c1066742-1066524 [Enterobacter cloacae]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELTVFYSAADHRLAELTMNKLYDKIPPSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT296092 WP_008499288.1 NZ_OW968328:c1067144-1066770 [Enterobacter cloacae]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5E1A1U8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |