Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | KacT-ataR/DUF1778(antitoxin) |
Location | 599803..600597 | Replicon | chromosome |
Accession | NZ_OW968328 | ||
Organism | Enterobacter cloacae isolate 1382 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | LQ108_RS02820 | Protein ID | WP_230134223.1 |
Coordinates | 599803..600324 (-) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A5E1AP76 |
Locus tag | LQ108_RS02825 | Protein ID | WP_013095428.1 |
Coordinates | 600328..600597 (-) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ108_RS02795 (AI2999V1_0543) | 595130..595291 | + | 162 | WP_003863073.1 | DUF1127 domain-containing protein | - |
LQ108_RS02800 (AI2999V1_0544) | 595378..596766 | - | 1389 | WP_230134221.1 | PLP-dependent aminotransferase family protein | - |
LQ108_RS02805 (AI2999V1_0545) | 596869..597348 | + | 480 | WP_013095424.1 | carboxymuconolactone decarboxylase family protein | - |
LQ108_RS02810 (AI2999V1_0546) | 597335..598237 | - | 903 | WP_038981742.1 | LysR family transcriptional regulator | - |
LQ108_RS02815 (AI2999V1_0547) | 598338..599753 | + | 1416 | WP_230134222.1 | aldehyde dehydrogenase family protein | - |
LQ108_RS02820 (AI2999V1_0548) | 599803..600324 | - | 522 | WP_230134223.1 | GNAT family N-acetyltransferase | Toxin |
LQ108_RS02825 (AI2999V1_0549) | 600328..600597 | - | 270 | WP_013095428.1 | DUF1778 domain-containing protein | Antitoxin |
LQ108_RS02830 (AI2999V1_0550) | 600812..601135 | + | 324 | WP_023620659.1 | antibiotic biosynthesis monooxygenase | - |
LQ108_RS02835 (AI2999V1_0551) | 601128..601526 | + | 399 | WP_029882197.1 | hypothetical protein | - |
LQ108_RS02840 (AI2999V1_0552) | 601498..602193 | + | 696 | WP_230134224.1 | winged helix-turn-helix domain-containing protein | - |
LQ108_RS02845 (AI2999V1_0553) | 602398..602868 | + | 471 | WP_013095432.1 | MarR family transcriptional regulator | - |
LQ108_RS02850 (AI2999V1_0554) | 602865..603932 | + | 1068 | WP_128311826.1 | HlyD family secretion protein | - |
LQ108_RS02855 (AI2999V1_0555) | 603922..604998 | + | 1077 | WP_230134225.1 | DUF2955 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19383.26 Da Isoelectric Point: 8.9007
>T296091 WP_230134223.1 NZ_OW968328:c600324-599803 [Enterobacter cloacae]
VNNMKIGIFSDDVEYDLSHFDCGEESLNTFLTAHLKRQHRGKFLRGYVLVASGEKPRVLGYYTLSGSCFEKAYLPSKTQQ
KRVPYKNVPSVTLGRLAIDTRFQGQGLGELLVTHALKTVYLASFAVGIHGIFVEALNDSAKNFYLKLGFIALQAENENTL
FLPTKTIERLFAD
VNNMKIGIFSDDVEYDLSHFDCGEESLNTFLTAHLKRQHRGKFLRGYVLVASGEKPRVLGYYTLSGSCFEKAYLPSKTQQ
KRVPYKNVPSVTLGRLAIDTRFQGQGLGELLVTHALKTVYLASFAVGIHGIFVEALNDSAKNFYLKLGFIALQAENENTL
FLPTKTIERLFAD
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|