Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 523383..523899 | Replicon | chromosome |
| Accession | NZ_OW968328 | ||
| Organism | Enterobacter cloacae isolate 1382 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | LQ108_RS02475 | Protein ID | WP_095427819.1 |
| Coordinates | 523615..523899 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V3EXX3 |
| Locus tag | LQ108_RS02470 | Protein ID | WP_008501400.1 |
| Coordinates | 523383..523625 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ108_RS02455 (AI2999V1_0478) | 519377..520117 | + | 741 | WP_219248979.1 | KDGP aldolase family protein | - |
| LQ108_RS02460 (AI2999V1_0479) | 520239..521375 | + | 1137 | WP_230134200.1 | lactonase family protein | - |
| LQ108_RS02465 (AI2999V1_0480) | 521395..523305 | + | 1911 | WP_058651172.1 | PRD domain-containing protein | - |
| LQ108_RS02470 (AI2999V1_0481) | 523383..523625 | + | 243 | WP_008501400.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| LQ108_RS02475 (AI2999V1_0482) | 523615..523899 | + | 285 | WP_095427819.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LQ108_RS02480 (AI2999V1_0483) | 523903..524367 | - | 465 | WP_230134201.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| LQ108_RS02485 (AI2999V1_0484) | 524490..526628 | - | 2139 | WP_013095357.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| LQ108_RS02490 (AI2999V1_0485) | 527002..528645 | - | 1644 | WP_230134202.1 | alpha,alpha-phosphotrehalase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11001.93 Da Isoelectric Point: 10.4610
>T296090 WP_095427819.1 NZ_OW968328:523615-523899 [Enterobacter cloacae]
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHTLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKLTVYHDANKRL
MTYELEFDPRALKEWSKLGETVKKQFRKKLAGVLVNPRIESARLHTLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGK
REKLTVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|