Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 178603..179207 | Replicon | chromosome |
Accession | NZ_OW968328 | ||
Organism | Enterobacter cloacae isolate 1382 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A421IJD5 |
Locus tag | LQ108_RS00865 | Protein ID | WP_071843252.1 |
Coordinates | 178603..178788 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A7Z1F6W0 |
Locus tag | LQ108_RS00870 | Protein ID | WP_013094943.1 |
Coordinates | 178803..179207 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ108_RS00850 (AI2999V1_0170) | 175034..176572 | + | 1539 | WP_020686520.1 | aldehyde dehydrogenase family protein | - |
LQ108_RS00855 (AI2999V1_0171) | 176569..177534 | - | 966 | WP_150057789.1 | LysR family transcriptional regulator | - |
LQ108_RS00860 (AI2999V1_0172) | 177652..178392 | + | 741 | WP_013094942.1 | MipA/OmpV family protein | - |
LQ108_RS00865 | 178603..178788 | + | 186 | WP_071843252.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
LQ108_RS00870 (AI2999V1_0173) | 178803..179207 | + | 405 | WP_013094943.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
LQ108_RS00875 (AI2999V1_0174) | 179261..181216 | - | 1956 | WP_230134124.1 | glycoside hydrolase family 127 protein | - |
LQ108_RS00880 (AI2999V1_0175) | 181227..182627 | - | 1401 | WP_020686524.1 | MFS transporter | - |
LQ108_RS00885 (AI2999V1_0176) | 182852..183670 | + | 819 | WP_020686525.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6859.08 Da Isoelectric Point: 11.7891
>T296089 WP_071843252.1 NZ_OW968328:178603-178788 [Enterobacter cloacae]
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
VKSADVITVLVRHGWKCVRTKGSHHQFRHPVHAGLVTVPHPKKDIKPGTLAQIWRQAGIKH
Download Length: 186 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14915.74 Da Isoelectric Point: 4.3036
>AT296089 WP_013094943.1 NZ_OW968328:178803-179207 [Enterobacter cloacae]
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP
MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALTAHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWL
LVDINMKQFDGKAERINITLPRRLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A421IJD5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7Z1F6W0 |