Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 101572..102197 Replicon plasmid P1
Accession NZ_OW968289
Organism Escherichia coli isolate 10

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LQ134_RS24105 Protein ID WP_000911313.1
Coordinates 101799..102197 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID V0VCB2
Locus tag LQ134_RS24100 Protein ID WP_000450520.1
Coordinates 101572..101799 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ134_RS24100 (101572) 101572..101799 + 228 WP_000450520.1 toxin-antitoxin system antitoxin VapB Antitoxin
LQ134_RS24105 (101799) 101799..102197 + 399 WP_000911313.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ134_RS25770 (102206) 102206..102337 - 132 WP_281440571.1 hypothetical protein -
LQ134_RS24110 (102410) 102410..103114 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
LQ134_RS24115 (103179) 103179..103421 - 243 Protein_110 DUF932 domain-containing protein -
LQ134_RS24120 (103539) 103539..103826 - 288 WP_000107535.1 hypothetical protein -
LQ134_RS24125 (103851) 103851..104057 - 207 WP_000547968.1 hypothetical protein -
LQ134_RS24130 (104127) 104127..104299 + 173 Protein_113 hypothetical protein -
LQ134_RS24135 (104297) 104297..104527 - 231 WP_071586998.1 hypothetical protein -
LQ134_RS24140 (104747) 104747..104872 - 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin -
LQ134_RS24145 (104814) 104814..104963 - 150 Protein_116 plasmid maintenance protein Mok -
- (104949) 104949..105173 - 225 NuclAT_0 - -
- (104949) 104949..105173 - 225 NuclAT_0 - -
- (104949) 104949..105173 - 225 NuclAT_0 - -
- (104949) 104949..105173 - 225 NuclAT_0 - -
LQ134_RS24150 (104985) 104985..105173 + 189 WP_001299721.1 hypothetical protein -
LQ134_RS24155 (105142) 105142..105904 - 763 Protein_118 plasmid SOS inhibition protein A -
LQ134_RS24160 (105901) 105901..106335 - 435 WP_000845936.1 conjugation system SOS inhibitor PsiB -
LQ134_RS24165 (106390) 106390..106587 - 198 Protein_120 hypothetical protein -
LQ134_RS24170 (106615) 106615..106848 - 234 WP_000005987.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sul1 / qacE / aadA5 / catA1 / tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..130092 130092


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(8-50)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14901.15 Da        Isoelectric Point: 7.8605

>T296077 WP_000911313.1 NZ_OW968289:101799-102197 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8596.63 Da        Isoelectric Point: 4.7513

>AT296077 WP_000450520.1 NZ_OW968289:101572-101799 [Escherichia coli]
METTVFFSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGETWDEWFDGHNVSADFMDNREQPGMQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB V0VCB2

References