Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4192008..4192843 | Replicon | chromosome |
| Accession | NZ_OW968288 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | LQ134_RS20355 | Protein ID | WP_000854759.1 |
| Coordinates | 4192008..4192385 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ134_RS20360 | Protein ID | WP_001295723.1 |
| Coordinates | 4192475..4192843 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ134_RS20325 (4187636) | 4187636..4188382 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ134_RS20330 (4188397) | 4188397..4189938 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| LQ134_RS20335 (4190532) | 4190532..4190708 | - | 177 | Protein_4000 | helix-turn-helix domain-containing protein | - |
| LQ134_RS20340 (4191075) | 4191075..4191224 | - | 150 | Protein_4001 | hypothetical protein | - |
| LQ134_RS20345 (4191330) | 4191330..4191506 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| LQ134_RS20350 (4191523) | 4191523..4192011 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| LQ134_RS20355 (4192008) | 4192008..4192385 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| LQ134_RS20360 (4192475) | 4192475..4192843 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ134_RS20365 (4193006) | 4193006..4193227 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ134_RS20370 (4193290) | 4193290..4193766 | - | 477 | WP_001186775.1 | RadC family protein | - |
| LQ134_RS20375 (4193782) | 4193782..4194255 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| LQ134_RS20380 (4194597) | 4194597..4195415 | - | 819 | WP_001234652.1 | DUF932 domain-containing protein | - |
| LQ134_RS20385 (4195533) | 4195533..4195728 | - | 196 | Protein_4010 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4179201..4211376 | 32175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T296075 WP_000854759.1 NZ_OW968288:c4192385-4192008 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT296075 WP_001295723.1 NZ_OW968288:c4192843-4192475 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |