Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4396506..4397125 | Replicon | chromosome |
| Accession | NZ_OW968280 | ||
| Organism | Klebsiella oxytoca isolate 101 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3N9D8 |
| Locus tag | LQ191_RS20740 | Protein ID | WP_004099646.1 |
| Coordinates | 4396907..4397125 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LQ191_RS20735 | Protein ID | WP_004099648.1 |
| Coordinates | 4396506..4396880 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ191_RS20725 (AI2946V1_4056) | 4391662..4392855 | + | 1194 | WP_004111040.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| LQ191_RS20730 (AI2946V1_4057) | 4392878..4396024 | + | 3147 | WP_004099650.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| LQ191_RS20735 (AI2946V1_4058) | 4396506..4396880 | + | 375 | WP_004099648.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ191_RS20740 (AI2946V1_4059) | 4396907..4397125 | + | 219 | WP_004099646.1 | HHA domain-containing protein | Toxin |
| LQ191_RS20745 (AI2946V1_4060) | 4397286..4397852 | + | 567 | WP_023320460.1 | maltose O-acetyltransferase | - |
| LQ191_RS20750 | 4397821..4397958 | - | 138 | WP_224226357.1 | hypothetical protein | - |
| LQ191_RS20755 (AI2946V1_4061) | 4397989..4398459 | + | 471 | WP_004099643.1 | YlaC family protein | - |
| LQ191_RS20760 (AI2946V1_4062) | 4398434..4399888 | - | 1455 | WP_126488646.1 | PLP-dependent aminotransferase family protein | - |
| LQ191_RS20765 (AI2946V1_4063) | 4399991..4400689 | + | 699 | WP_004099639.1 | GNAT family protein | - |
| LQ191_RS20770 (AI2946V1_4064) | 4400686..4400826 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| LQ191_RS20775 (AI2946V1_4065) | 4400826..4401089 | - | 264 | WP_004099638.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8640.05 Da Isoelectric Point: 8.9008
>T296055 WP_004099646.1 NZ_OW968280:4396907-4397125 [Klebsiella oxytoca]
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
MSDKTLTKIDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPPSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14350.09 Da Isoelectric Point: 4.8989
>AT296055 WP_004099648.1 NZ_OW968280:4396506-4396880 [Klebsiella oxytoca]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIAAFALNYKIKYAEDNKLVTQLDEYL
DDTFVLFSNYGINTADLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|