Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1323297..1324069 | Replicon | chromosome |
| Accession | NZ_OW968280 | ||
| Organism | Klebsiella oxytoca isolate 101 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | LQ191_RS06375 | Protein ID | WP_032938032.1 |
| Coordinates | 1323297..1323671 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | LQ191_RS06380 | Protein ID | WP_049101822.1 |
| Coordinates | 1323710..1324069 (-) | Length | 120 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ191_RS06350 (AI2946V1_1241) | 1318979..1319212 | - | 234 | WP_004132711.1 | hypothetical protein | - |
| LQ191_RS06355 | 1319612..1319884 | + | 273 | WP_016247220.1 | hypothetical protein | - |
| LQ191_RS06360 (AI2946V1_1243) | 1320087..1320995 | + | 909 | WP_032938037.1 | kdo(2)-lipid IV(A) palmitoleoyltransferase | - |
| LQ191_RS06365 (AI2946V1_1244) | 1321769..1322758 | + | 990 | WP_047058004.1 | glycosyltransferase | - |
| LQ191_RS06370 (AI2946V1_1245) | 1322762..1323217 | + | 456 | WP_223226960.1 | hypothetical protein | - |
| LQ191_RS06375 (AI2946V1_1247) | 1323297..1323671 | - | 375 | WP_032938032.1 | TA system toxin CbtA family protein | Toxin |
| LQ191_RS06380 (AI2946V1_1248) | 1323710..1324069 | - | 360 | WP_049101822.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ191_RS06385 (AI2946V1_1249) | 1324092..1324313 | - | 222 | WP_032938028.1 | DUF987 domain-containing protein | - |
| LQ191_RS06390 (AI2946V1_1250) | 1324327..1324809 | - | 483 | WP_032938026.1 | DNA repair protein RadC | - |
| LQ191_RS06395 (AI2946V1_1252) | 1325050..1325529 | - | 480 | WP_075206252.1 | antirestriction protein | - |
| LQ191_RS06400 (AI2946V1_1253) | 1325609..1326430 | - | 822 | WP_071067384.1 | DUF932 domain-containing protein | - |
| LQ191_RS06405 (AI2946V1_1254) | 1326541..1326753 | - | 213 | WP_032938024.1 | hypothetical protein | - |
| LQ191_RS06410 (AI2946V1_1255) | 1326863..1327336 | - | 474 | WP_189095326.1 | hypothetical protein | - |
| LQ191_RS06415 (AI2946V1_1256) | 1327410..1328039 | - | 630 | WP_032938019.1 | hypothetical protein | - |
| LQ191_RS06420 (AI2946V1_1257) | 1328137..1328814 | - | 678 | WP_032938016.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1320087..1346072 | 25985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13903.92 Da Isoelectric Point: 9.7700
>T296050 WP_032938032.1 NZ_OW968280:c1323671-1323297 [Klebsiella oxytoca]
MQIQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDMLRDRKATGLMTRKGYKTVTDITGGRFSGGK
MQIQSLPPQRAASSRLSSVKIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNFIVEKYDLVRTDRHGF
SVKEQSPFIGSLDMLRDRKATGLMTRKGYKTVTDITGGRFSGGK
Download Length: 375 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13393.59 Da Isoelectric Point: 8.8636
>AT296050 WP_049101822.1 NZ_OW968280:c1324069-1323710 [Klebsiella oxytoca]
MQKATRVINHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDADLRHLDQAFPLLMKQMELMLTSSELM
PRIQRCITLHAKGLICKADTLGSCGYLYIVIYPASATTA
MQKATRVINHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDADLRHLDQAFPLLMKQMELMLTSSELM
PRIQRCITLHAKGLICKADTLGSCGYLYIVIYPASATTA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|