Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 97826..98351 | Replicon | plasmid P1 |
| Accession | NZ_OW968278 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | LQ166_RS26195 | Protein ID | WP_001159871.1 |
| Coordinates | 98046..98351 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | LQ166_RS26190 | Protein ID | WP_000813630.1 |
| Coordinates | 97826..98044 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ166_RS26165 | 93036..93722 | + | 687 | Protein_109 | IS1 family transposase | - |
| LQ166_RS26170 | 93976..94998 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
| LQ166_RS26175 | 94983..96548 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
| LQ166_RS26180 | 96623..97039 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| LQ166_RS26185 | 97036..97266 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| LQ166_RS26190 | 97826..98044 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| LQ166_RS26195 | 98046..98351 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| LQ166_RS26200 | 98352..99158 | + | 807 | WP_000016970.1 | site-specific integrase | - |
| LQ166_RS26205 | 99880..100635 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| LQ166_RS26210 | 101223..102389 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaOXA-48 / aadA5 / qacE / sul1 / mph(A) / tet(A) | - | 1..128607 | 128607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T296048 WP_001159871.1 NZ_OW968278:98046-98351 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |