Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 96623..97266 | Replicon | plasmid P1 |
Accession | NZ_OW968278 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | LQ166_RS26180 | Protein ID | WP_001034044.1 |
Coordinates | 96623..97039 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | LQ166_RS26185 | Protein ID | WP_001261286.1 |
Coordinates | 97036..97266 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ166_RS26155 (91726) | 91726..92454 | - | 729 | WP_001230787.1 | type-F conjugative transfer system secretin TraK | - |
LQ166_RS26160 (92441) | 92441..92971 | - | 531 | WP_001324649.1 | type IV conjugative transfer system protein TraE | - |
LQ166_RS26165 (93036) | 93036..93722 | + | 687 | Protein_109 | IS1 family transposase | - |
LQ166_RS26170 (93976) | 93976..94998 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
LQ166_RS26175 (94983) | 94983..96548 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
LQ166_RS26180 (96623) | 96623..97039 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ166_RS26185 (97036) | 97036..97266 | - | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
LQ166_RS26190 (97826) | 97826..98044 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
LQ166_RS26195 (98046) | 98046..98351 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
LQ166_RS26200 (98352) | 98352..99158 | + | 807 | WP_000016970.1 | site-specific integrase | - |
LQ166_RS26205 (99880) | 99880..100635 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaOXA-48 / aadA5 / qacE / sul1 / mph(A) / tet(A) | - | 1..128607 | 128607 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T296047 WP_001034044.1 NZ_OW968278:c97039-96623 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |