296037

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3807887..3808721 Replicon chromosome
Accession NZ_OW968277
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag LQ166_RS18700 Protein ID WP_000854690.1
Coordinates 3807887..3808264 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag LQ166_RS18705 Protein ID WP_001305076.1
Coordinates 3808353..3808721 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ166_RS18670 (3804281) 3804281..3804451 - 171 Protein_3652 IS110 family transposase -
LQ166_RS18675 (3804868) 3804868..3805801 - 934 Protein_3653 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
LQ166_RS18680 (3805794) 3805794..3806189 - 396 WP_000208384.1 DUF6088 family protein -
LQ166_RS18685 (3806258) 3806258..3807103 - 846 WP_001529401.1 DUF4942 domain-containing protein -
LQ166_RS18690 (3807188) 3807188..3807385 - 198 WP_000839293.1 DUF957 domain-containing protein -
LQ166_RS18695 (3807402) 3807402..3807890 - 489 WP_000761699.1 DUF5983 family protein -
LQ166_RS18700 (3807887) 3807887..3808264 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
LQ166_RS18705 (3808353) 3808353..3808721 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ166_RS18710 (3808771) 3808771..3809415 - 645 WP_000094916.1 hypothetical protein -
LQ166_RS18715 (3809434) 3809434..3809655 - 222 WP_000692329.1 DUF987 domain-containing protein -
LQ166_RS18720 (3809718) 3809718..3810194 - 477 WP_001186726.1 RadC family protein -
LQ166_RS18725 (3810210) 3810210..3810695 - 486 WP_000849565.1 antirestriction protein -
LQ166_RS18730 (3810750) 3810750..3811568 - 819 WP_001234620.1 DUF932 domain-containing protein -
LQ166_RS18735 (3811669) 3811669..3811902 - 234 WP_000902034.1 DUF905 family protein -
LQ166_RS18740 (3811981) 3811981..3812436 - 456 WP_000581502.1 IrmA family protein -
LQ166_RS18745 (3812512) 3812512..3813639 - 1128 Protein_3667 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 3786270..3810695 24425


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T296037 WP_000854690.1 NZ_OW968277:c3808264-3807887 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT296037 WP_001305076.1 NZ_OW968277:c3808721-3808353 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References