Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 2459640..2460441 | Replicon | chromosome |
Accession | NZ_OW968277 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | LQ166_RS12310 | Protein ID | WP_001094436.1 |
Coordinates | 2460064..2460441 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | LQ166_RS12305 | Protein ID | WP_015953067.1 |
Coordinates | 2459640..2460017 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ166_RS12270 (2455551) | 2455551..2456231 | + | 681 | WP_001282919.1 | WYL domain-containing protein | - |
LQ166_RS12275 (2456379) | 2456379..2457056 | + | 678 | WP_001097301.1 | hypothetical protein | - |
LQ166_RS12280 (2457062) | 2457062..2457295 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
LQ166_RS12285 (2457385) | 2457385..2458203 | + | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
LQ166_RS12290 (2458295) | 2458295..2458780 | + | 486 | WP_029700724.1 | antirestriction protein | - |
LQ166_RS12295 (2458795) | 2458795..2459271 | + | 477 | WP_001186756.1 | RadC family protein | - |
LQ166_RS12300 (2459340) | 2459340..2459561 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
LQ166_RS12305 (2459640) | 2459640..2460017 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
LQ166_RS12310 (2460064) | 2460064..2460441 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
LQ166_RS12315 (2460438) | 2460438..2460926 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
LQ166_RS12320 (2460938) | 2460938..2461135 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
LQ166_RS12325 (2461220) | 2461220..2461930 | + | 711 | WP_001621817.1 | DUF4942 domain-containing protein | - |
LQ166_RS12330 (2461979) | 2461979..2462734 | - | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
LQ166_RS12335 (2462731) | 2462731..2464230 | - | 1500 | WP_029700729.1 | IS21-like element ISEc10 family transposase | - |
LQ166_RS12340 (2464321) | 2464321..2464482 | + | 162 | Protein_2425 | DUF4942 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T296031 WP_001094436.1 NZ_OW968277:2460064-2460441 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT296031 WP_015953067.1 NZ_OW968277:2459640-2460017 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |