Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 2160351..2161186 | Replicon | chromosome |
| Accession | NZ_OW968277 | ||
| Organism | Escherichia coli isolate 131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | LQ166_RS10785 | Protein ID | WP_000854759.1 |
| Coordinates | 2160351..2160728 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ166_RS10790 | Protein ID | WP_001295723.1 |
| Coordinates | 2160818..2161186 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ166_RS26490 (2156160) | 2156160..2156465 | - | 306 | Protein_2113 | helix-turn-helix domain-containing protein | - |
| LQ166_RS10760 (2156657) | 2156657..2157403 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ166_RS10765 (2157418) | 2157418..2158959 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| LQ166_RS10770 (2159418) | 2159418..2159567 | - | 150 | Protein_2116 | hypothetical protein | - |
| LQ166_RS10775 (2159673) | 2159673..2159849 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| LQ166_RS10780 (2159866) | 2159866..2160354 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| LQ166_RS10785 (2160351) | 2160351..2160728 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| LQ166_RS10790 (2160818) | 2160818..2161186 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ166_RS10795 (2161349) | 2161349..2161570 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ166_RS10800 (2161633) | 2161633..2162109 | - | 477 | WP_001186775.1 | RadC family protein | - |
| LQ166_RS10805 (2162125) | 2162125..2162598 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| LQ166_RS10810 (2162940) | 2162940..2163758 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| LQ166_RS10815 (2163876) | 2163876..2164071 | - | 196 | Protein_2125 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T296029 WP_000854759.1 NZ_OW968277:c2160728-2160351 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT296029 WP_001295723.1 NZ_OW968277:c2161186-2160818 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |