Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 1966973..1967493 Replicon chromosome
Accession NZ_OW968277
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag LQ166_RS09855 Protein ID WP_001160964.1
Coordinates 1966973..1967257 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag LQ166_RS09860 Protein ID WP_000125566.1
Coordinates 1967260..1967493 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ166_RS09830 (1962618) 1962618..1963904 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
LQ166_RS09835 (1963904) 1963904..1964893 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
LQ166_RS09840 (1964890) 1964890..1965711 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
LQ166_RS09845 (1965714) 1965714..1966091 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
LQ166_RS09850 (1966098) 1966098..1966946 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
LQ166_RS09855 (1966973) 1966973..1967257 - 285 WP_001160964.1 CcdB family protein Toxin
LQ166_RS09860 (1967260) 1967260..1967493 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
LQ166_RS09865 (1967579) 1967579..1968058 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
LQ166_RS09870 (1968250) 1968250..1970112 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
LQ166_RS09875 (1970105) 1970105..1970635 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
LQ166_RS09880 (1970743) 1970743..1972074 - 1332 WP_001183209.1 MFS transporter -
LQ166_RS09885 (1972133) 1972133..1972420 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T296027 WP_001160964.1 NZ_OW968277:c1967257-1966973 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT296027 WP_000125566.1 NZ_OW968277:c1967493-1967260 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References