Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1515295..1515913 | Replicon | chromosome |
Accession | NZ_OW968277 | ||
Organism | Escherichia coli isolate 131 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ166_RS07695 | Protein ID | WP_001291435.1 |
Coordinates | 1515695..1515913 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ166_RS07690 | Protein ID | WP_000344800.1 |
Coordinates | 1515295..1515669 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ166_RS07680 (1510384) | 1510384..1511577 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ166_RS07685 (1511600) | 1511600..1514749 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
LQ166_RS07690 (1515295) | 1515295..1515669 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ166_RS07695 (1515695) | 1515695..1515913 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ166_RS07700 (1516087) | 1516087..1516638 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
LQ166_RS07705 (1516754) | 1516754..1517224 | + | 471 | WP_000136192.1 | YlaC family protein | - |
LQ166_RS07710 (1517388) | 1517388..1518938 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ166_RS07715 (1518980) | 1518980..1519333 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
LQ166_RS07725 (1519712) | 1519712..1520023 | + | 312 | WP_000409908.1 | MGMT family protein | - |
LQ166_RS07730 (1520054) | 1520054..1520626 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T296025 WP_001291435.1 NZ_OW968277:1515695-1515913 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT296025 WP_000344800.1 NZ_OW968277:1515295-1515669 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |