296022

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 828140..828971 Replicon chromosome
Accession NZ_OW968277
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag LQ166_RS04295 Protein ID WP_000854815.1
Coordinates 828597..828971 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag LQ166_RS04290 Protein ID WP_001280918.1
Coordinates 828140..828508 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ166_RS04245 (823229) 823229..823975 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
LQ166_RS04250 (824058) 824058..824408 + 351 Protein_840 hypothetical protein -
LQ166_RS04255 (824424) 824424..824834 + 411 WP_000846703.1 hypothetical protein -
LQ166_RS04260 (825055) 825055..825873 + 819 WP_001542275.1 DUF932 domain-containing protein -
LQ166_RS04265 (825873) 825873..826118 + 246 WP_001164966.1 hypothetical protein -
LQ166_RS04270 (826212) 826212..826685 + 474 WP_001542276.1 antirestriction protein -
LQ166_RS04275 (826701) 826701..827177 + 477 WP_001186200.1 RadC family protein -
LQ166_RS04280 (827240) 827240..827461 + 222 WP_000692345.1 DUF987 domain-containing protein -
LQ166_RS04285 (827480) 827480..828124 + 645 WP_000086752.1 hypothetical protein -
LQ166_RS04290 (828140) 828140..828508 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
LQ166_RS04295 (828597) 828597..828971 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LQ166_RS04300 (828968) 828968..829162 + 195 WP_000988600.1 DUF5983 family protein -
LQ166_RS04305 (829208) 829208..829288 + 81 Protein_851 hypothetical protein -
LQ166_RS04310 (829577) 829577..829657 - 81 WP_023441679.1 hypothetical protein -
LQ166_RS04315 (829636) 829636..829959 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
LQ166_RS04320 (830060) 830060..830389 - 330 WP_000450409.1 DUF496 family protein -
LQ166_RS04325 (830561) 830561..831619 - 1059 WP_001200889.1 FUSC family protein -
LQ166_RS04330 (831817) 831817..832290 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
LQ166_RS04335 (832409) 832409..833575 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T296022 WP_000854815.1 NZ_OW968277:828597-828971 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT296022 WP_001280918.1 NZ_OW968277:828140-828508 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References