Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 78273..78898 | Replicon | plasmid P1 |
| Accession | NZ_OW968125 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | LQ159_RS24055 | Protein ID | WP_000911313.1 |
| Coordinates | 78500..78898 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | LQ159_RS24050 | Protein ID | WP_000450520.1 |
| Coordinates | 78273..78500 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ159_RS24050 (78273) | 78273..78500 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| LQ159_RS24055 (78500) | 78500..78898 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| LQ159_RS24060 (78907) | 78907..79044 | - | 138 | WP_230163687.1 | hypothetical protein | - |
| LQ159_RS24065 (79111) | 79111..79815 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| LQ159_RS24070 (79880) | 79880..80122 | - | 243 | Protein_82 | DUF932 domain-containing protein | - |
| LQ159_RS24075 (80240) | 80240..80527 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| LQ159_RS24080 (80552) | 80552..80758 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| LQ159_RS24085 (80828) | 80828..81000 | + | 173 | Protein_85 | hypothetical protein | - |
| LQ159_RS24090 (80998) | 80998..81228 | - | 231 | WP_071586998.1 | hypothetical protein | - |
| LQ159_RS24095 (81448) | 81448..81573 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | - |
| LQ159_RS24100 (81515) | 81515..81664 | - | 150 | Protein_88 | plasmid maintenance protein Mok | - |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | - |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | - |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | - |
| - (81650) | 81650..81874 | - | 225 | NuclAT_0 | - | - |
| LQ159_RS24105 (81686) | 81686..81874 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| LQ159_RS24110 (81843) | 81843..82605 | - | 763 | Protein_90 | plasmid SOS inhibition protein A | - |
| LQ159_RS24115 (82602) | 82602..83036 | - | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
| LQ159_RS24120 (83091) | 83091..83288 | - | 198 | Protein_92 | hypothetical protein | - |
| LQ159_RS24125 (83316) | 83316..83549 | - | 234 | WP_000005987.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..106836 | 106836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T296009 WP_000911313.1 NZ_OW968125:78500-78898 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|