Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4214280..4215115 | Replicon | chromosome |
| Accession | NZ_OW968124 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | LQ159_RS20505 | Protein ID | WP_000854759.1 |
| Coordinates | 4214280..4214657 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ159_RS20510 | Protein ID | WP_001295723.1 |
| Coordinates | 4214747..4215115 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ159_RS20475 (4209908) | 4209908..4210654 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ159_RS20480 (4210669) | 4210669..4212210 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| LQ159_RS20485 (4212804) | 4212804..4212980 | - | 177 | Protein_4029 | helix-turn-helix domain-containing protein | - |
| LQ159_RS20490 (4213347) | 4213347..4213496 | - | 150 | Protein_4030 | hypothetical protein | - |
| LQ159_RS20495 (4213602) | 4213602..4213778 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| LQ159_RS20500 (4213795) | 4213795..4214283 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| LQ159_RS20505 (4214280) | 4214280..4214657 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| LQ159_RS20510 (4214747) | 4214747..4215115 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ159_RS20515 (4215278) | 4215278..4215499 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ159_RS20520 (4215562) | 4215562..4216038 | - | 477 | WP_001186775.1 | RadC family protein | - |
| LQ159_RS20525 (4216054) | 4216054..4216527 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| LQ159_RS20530 (4216869) | 4216869..4217687 | - | 819 | WP_001234652.1 | DUF932 domain-containing protein | - |
| LQ159_RS20535 (4217805) | 4217805..4218000 | - | 196 | Protein_4039 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4201473..4233648 | 32175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T296003 WP_000854759.1 NZ_OW968124:c4214657-4214280 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT296003 WP_001295723.1 NZ_OW968124:c4215115-4214747 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |