Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2507597..2508235 | Replicon | chromosome |
Accession | NZ_OW968124 | ||
Organism | Escherichia coli isolate 10 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
Locus tag | LQ159_RS12205 | Protein ID | WP_001447010.1 |
Coordinates | 2508059..2508235 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | LQ159_RS12200 | Protein ID | WP_001270286.1 |
Coordinates | 2507597..2508013 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ159_RS12180 (2502749) | 2502749..2503690 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
LQ159_RS12185 (2503691) | 2503691..2504704 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
LQ159_RS12190 (2504722) | 2504722..2505867 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
LQ159_RS12195 (2506112) | 2506112..2507518 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
LQ159_RS12200 (2507597) | 2507597..2508013 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
LQ159_RS12205 (2508059) | 2508059..2508235 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
LQ159_RS12210 (2508457) | 2508457..2508687 | + | 231 | WP_000494244.1 | YncJ family protein | - |
LQ159_RS12215 (2508779) | 2508779..2510740 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
LQ159_RS12220 (2510813) | 2510813..2511349 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
LQ159_RS12225 (2511441) | 2511441..2512616 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T295998 WP_001447010.1 NZ_OW968124:c2508235-2508059 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT295998 WP_001270286.1 NZ_OW968124:c2508013-2507597 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|