Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 111496..112121 | Replicon | plasmid P1 |
Accession | NZ_OW968112 | ||
Organism | Escherichia coli isolate 602 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LQ120_RS23710 | Protein ID | WP_000911313.1 |
Coordinates | 111496..111894 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | LQ120_RS23715 | Protein ID | WP_000450520.1 |
Coordinates | 111894..112121 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ120_RS23690 (106780) | 106780..107805 | + | 1026 | Protein_113 | conjugal transfer protein TraG | - |
LQ120_RS23695 (107821) | 107821..108318 | + | 498 | WP_000605857.1 | entry exclusion protein | - |
LQ120_RS23700 (108350) | 108350..109081 | + | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
LQ120_RS23705 (109334) | 109334..111487 | + | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
LQ120_RS23710 (111496) | 111496..111894 | - | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ120_RS23715 (111894) | 111894..112121 | - | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | oqxA / oqxB / catA1 / tet(B) / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD | iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA | 1..160357 | 160357 | |
- | flank | IS/Tn | - | - | 105465..106673 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T295979 WP_000911313.1 NZ_OW968112:c111894-111496 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|