Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 3521316..3522153 | Replicon | chromosome |
Accession | NZ_OW968111 | ||
Organism | Escherichia coli isolate 602 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | LQ120_RS17130 | Protein ID | WP_000227784.1 |
Coordinates | 3521611..3522153 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | LQ120_RS17125 | Protein ID | WP_001297137.1 |
Coordinates | 3521316..3521627 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ120_RS17100 (3516336) | 3516336..3517283 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
LQ120_RS17105 (3517305) | 3517305..3519296 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
LQ120_RS17110 (3519286) | 3519286..3519900 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
LQ120_RS17115 (3519900) | 3519900..3520229 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
LQ120_RS17120 (3520241) | 3520241..3521131 | + | 891 | WP_000971336.1 | heme o synthase | - |
LQ120_RS17125 (3521316) | 3521316..3521627 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
LQ120_RS17130 (3521611) | 3521611..3522153 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
LQ120_RS17135 (3522209) | 3522209..3523144 | - | 936 | WP_001368479.1 | tetratricopeptide repeat protein | - |
LQ120_RS17140 (3523552) | 3523552..3524916 | + | 1365 | WP_001000960.1 | MFS transporter | - |
LQ120_RS17145 (3525044) | 3525044..3525535 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
LQ120_RS17150 (3525703) | 3525703..3526614 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T295975 WP_000227784.1 NZ_OW968111:3521611-3522153 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|