Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1328220..1328845 | Replicon | chromosome |
Accession | NZ_OW968111 | ||
Organism | Escherichia coli isolate 602 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LQ120_RS06410 | Protein ID | WP_000911330.1 |
Coordinates | 1328447..1328845 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | LQ120_RS06405 | Protein ID | WP_000450524.1 |
Coordinates | 1328220..1328447 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ120_RS06380 (1324023) | 1324023..1324493 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
LQ120_RS06385 (1324493) | 1324493..1325065 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
LQ120_RS06390 (1325211) | 1325211..1326089 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
LQ120_RS06395 (1326106) | 1326106..1327140 | + | 1035 | WP_001330579.1 | outer membrane protein assembly factor BamC | - |
LQ120_RS06400 (1327353) | 1327353..1328066 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
LQ120_RS06405 (1328220) | 1328220..1328447 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
LQ120_RS06410 (1328447) | 1328447..1328845 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ120_RS06415 (1328992) | 1328992..1329855 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
LQ120_RS06420 (1329870) | 1329870..1331885 | + | 2016 | WP_063112794.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
LQ120_RS06425 (1331959) | 1331959..1332657 | + | 699 | WP_000679823.1 | esterase | - |
LQ120_RS06430 (1332767) | 1332767..1332967 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T295967 WP_000911330.1 NZ_OW968111:1328447-1328845 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|