Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 893826..894480 | Replicon | chromosome |
Accession | NZ_OW968111 | ||
Organism | Escherichia coli isolate 602 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | LQ120_RS04345 | Protein ID | WP_063112724.1 |
Coordinates | 894073..894480 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | LQ120_RS04340 | Protein ID | WP_000354046.1 |
Coordinates | 893826..894092 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ120_RS04315 (889114) | 889114..889857 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
LQ120_RS04320 (889914) | 889914..891347 | - | 1434 | WP_001307385.1 | 6-phospho-beta-glucosidase BglA | - |
LQ120_RS04325 (891392) | 891392..891703 | + | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
LQ120_RS04330 (891867) | 891867..892526 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
LQ120_RS04335 (892603) | 892603..893583 | - | 981 | WP_001472148.1 | tRNA-modifying protein YgfZ | - |
LQ120_RS04340 (893826) | 893826..894092 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
LQ120_RS04345 (894073) | 894073..894480 | + | 408 | WP_063112724.1 | protein YgfX | Toxin |
LQ120_RS04350 (894520) | 894520..895041 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
LQ120_RS04355 (895153) | 895153..896049 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
LQ120_RS04360 (896074) | 896074..896784 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
LQ120_RS04365 (896790) | 896790..898523 | + | 1734 | WP_000813210.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16082.04 Da Isoelectric Point: 11.2511
>T295965 WP_063112724.1 NZ_OW968111:894073-894480 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLFHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLFHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |