Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 779377..780212 Replicon chromosome
Accession NZ_OW968111
Organism Escherichia coli isolate 602

Toxin (Protein)


Gene name yeeV Uniprot ID A0A1C0Y405
Locus tag LQ120_RS03785 Protein ID WP_001774607.1
Coordinates 779377..779754 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A1M2U6P5
Locus tag LQ120_RS03790 Protein ID WP_001774606.1
Coordinates 779844..780212 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ120_RS03755 (774785) 774785..775762 + 978 WP_000633238.1 type II secretion system minor pseudopilin GspK -
LQ120_RS03760 (775759) 775759..776937 + 1179 WP_000094973.1 type II secretion system protein GspL -
LQ120_RS03765 (776939) 776939..777475 + 537 WP_000942799.1 GspM family type II secretion system protein YghD -
LQ120_RS03770 (777756) 777756..778598 - 843 WP_040235333.1 DUF4942 domain-containing protein -
LQ120_RS03775 (778683) 778683..778880 - 198 WP_032152719.1 DUF957 domain-containing protein -
LQ120_RS03780 (778892) 778892..779380 - 489 WP_001774608.1 DUF5983 family protein -
LQ120_RS03785 (779377) 779377..779754 - 378 WP_001774607.1 TA system toxin CbtA family protein Toxin
LQ120_RS03790 (779844) 779844..780212 - 369 WP_001774606.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
LQ120_RS03795 (780262) 780262..780906 - 645 WP_001774605.1 hypothetical protein -
LQ120_RS03800 (780925) 780925..781146 - 222 WP_000692312.1 DUF987 domain-containing protein -
LQ120_RS03805 (781209) 781209..781685 - 477 WP_001297237.1 RadC family protein -
LQ120_RS03810 (781701) 781701..782180 - 480 WP_032152717.1 antirestriction protein -
LQ120_RS03815 (782519) 782519..783337 - 819 WP_016238867.1 DUF932 domain-containing protein -
LQ120_RS03820 (783436) 783436..783669 - 234 WP_001278287.1 DUF905 family protein -
LQ120_RS03825 (783675) 783675..784352 - 678 WP_144745839.1 hypothetical protein -
LQ120_RS03830 (784500) 784500..785180 - 681 WP_032082725.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 777629..821068 43439


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14218.20 Da        Isoelectric Point: 7.8045

>T295964 WP_001774607.1 NZ_OW968111:c779754-779377 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.31 Da        Isoelectric Point: 5.8746

>AT295964 WP_001774606.1 NZ_OW968111:c780212-779844 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C0Y405

Antitoxin

Source ID Structure
AlphaFold DB A0A1M2U6P5

References