Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 779377..780212 | Replicon | chromosome |
| Accession | NZ_OW968111 | ||
| Organism | Escherichia coli isolate 602 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1C0Y405 |
| Locus tag | LQ120_RS03785 | Protein ID | WP_001774607.1 |
| Coordinates | 779377..779754 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M2U6P5 |
| Locus tag | LQ120_RS03790 | Protein ID | WP_001774606.1 |
| Coordinates | 779844..780212 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ120_RS03755 (774785) | 774785..775762 | + | 978 | WP_000633238.1 | type II secretion system minor pseudopilin GspK | - |
| LQ120_RS03760 (775759) | 775759..776937 | + | 1179 | WP_000094973.1 | type II secretion system protein GspL | - |
| LQ120_RS03765 (776939) | 776939..777475 | + | 537 | WP_000942799.1 | GspM family type II secretion system protein YghD | - |
| LQ120_RS03770 (777756) | 777756..778598 | - | 843 | WP_040235333.1 | DUF4942 domain-containing protein | - |
| LQ120_RS03775 (778683) | 778683..778880 | - | 198 | WP_032152719.1 | DUF957 domain-containing protein | - |
| LQ120_RS03780 (778892) | 778892..779380 | - | 489 | WP_001774608.1 | DUF5983 family protein | - |
| LQ120_RS03785 (779377) | 779377..779754 | - | 378 | WP_001774607.1 | TA system toxin CbtA family protein | Toxin |
| LQ120_RS03790 (779844) | 779844..780212 | - | 369 | WP_001774606.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| LQ120_RS03795 (780262) | 780262..780906 | - | 645 | WP_001774605.1 | hypothetical protein | - |
| LQ120_RS03800 (780925) | 780925..781146 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| LQ120_RS03805 (781209) | 781209..781685 | - | 477 | WP_001297237.1 | RadC family protein | - |
| LQ120_RS03810 (781701) | 781701..782180 | - | 480 | WP_032152717.1 | antirestriction protein | - |
| LQ120_RS03815 (782519) | 782519..783337 | - | 819 | WP_016238867.1 | DUF932 domain-containing protein | - |
| LQ120_RS03820 (783436) | 783436..783669 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| LQ120_RS03825 (783675) | 783675..784352 | - | 678 | WP_144745839.1 | hypothetical protein | - |
| LQ120_RS03830 (784500) | 784500..785180 | - | 681 | WP_032082725.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 777629..821068 | 43439 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14218.20 Da Isoelectric Point: 7.8045
>T295964 WP_001774607.1 NZ_OW968111:c779754-779377 [Escherichia coli]
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPPPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDTVNFLVEKYALIRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.31 Da Isoelectric Point: 5.8746
>AT295964 WP_001774606.1 NZ_OW968111:c780212-779844 [Escherichia coli]
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
VSDTLSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C0Y405 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2U6P5 |