Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 53237..53784 Replicon plasmid P1
Accession NZ_OW968012
Organism Escherichia coli isolate 58

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag LQ149_RS23080 Protein ID WP_001384452.1
Coordinates 53237..53515 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag LQ149_RS23085 Protein ID WP_000079941.1
Coordinates 53515..53784 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ149_RS23050 (48667) 48667..48927 + 261 WP_000343091.1 hypothetical protein -
LQ149_RS23055 (48924) 48924..49514 + 591 WP_001518980.1 hypothetical protein -
LQ149_RS23060 (49576) 49576..49791 - 216 Protein_44 DUF6404 family protein -
LQ149_RS23065 (49920) 49920..50255 + 336 WP_001080729.1 colicin 1A immunity protein -
LQ149_RS23070 (50277) 50277..52157 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
LQ149_RS23075 (52343) 52343..53191 - 849 WP_001057989.1 3'-5' exonuclease -
LQ149_RS23080 (53237) 53237..53515 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
LQ149_RS23085 (53515) 53515..53784 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
LQ149_RS23090 (54428) 54428..56179 - 1752 Protein_50 Tn3-like element TnAs1 family transposase -
LQ149_RS23095 (56183) 56183..56575 + 393 WP_001351729.1 isochorismatase family cysteine hydrolase -
LQ149_RS23100 (56713) 56713..57597 + 885 WP_000058717.1 EamA family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA5 / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..154854 154854


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T295961 WP_001384452.1 NZ_OW968012:c53515-53237 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT295961 WP_000079941.1 NZ_OW968012:c53784-53515 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References