Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4738443..4739287 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | B1LJY4 |
| Locus tag | LQ149_RS22680 | Protein ID | WP_000854686.1 |
| Coordinates | 4738904..4739287 (+) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A8E0J1S3 |
| Locus tag | LQ149_RS22675 | Protein ID | WP_001285602.1 |
| Coordinates | 4738443..4738823 (+) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS22640 (4734692) | 4734692..4735147 | + | 456 | WP_001504120.1 | IrmA family protein | - |
| LQ149_RS22645 (4735226) | 4735226..4735459 | + | 234 | WP_001119717.1 | DUF905 family protein | - |
| LQ149_RS22650 (4735559) | 4735559..4736377 | + | 819 | WP_001234732.1 | DUF932 domain-containing protein | - |
| LQ149_RS22655 (4736469) | 4736469..4736954 | + | 486 | WP_000214307.1 | antirestriction protein | - |
| LQ149_RS22660 (4736970) | 4736970..4737446 | + | 477 | WP_001186726.1 | RadC family protein | - |
| LQ149_RS22665 (4737509) | 4737509..4737730 | + | 222 | WP_000692298.1 | DUF987 domain-containing protein | - |
| LQ149_RS22670 (4737749) | 4737749..4738432 | + | 684 | WP_000086768.1 | hypothetical protein | - |
| LQ149_RS22675 (4738443) | 4738443..4738823 | + | 381 | WP_001285602.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ149_RS22680 (4738904) | 4738904..4739287 | + | 384 | WP_000854686.1 | TA system toxin CbtA family protein | Toxin |
| LQ149_RS22685 (4739284) | 4739284..4739772 | + | 489 | WP_001054233.1 | DUF5983 family protein | - |
| LQ149_RS22690 (4739789) | 4739789..4739986 | + | 198 | WP_000839253.1 | DUF957 domain-containing protein | - |
| LQ149_RS22695 (4740071) | 4740071..4740913 | + | 843 | WP_074767346.1 | DUF4942 domain-containing protein | - |
| LQ149_RS22705 (4741404) | 4741404..4741622 | - | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| LQ149_RS22710 (4741907) | 4741907..4742611 | - | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4716401..4739287 | 22886 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14272.28 Da Isoelectric Point: 6.8614
>T295960 WP_000854686.1 NZ_OW968011:4738904-4739287 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ
Download Length: 384 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 13938.69 Da Isoelectric Point: 5.0823
>AT295960 WP_001285602.1 NZ_OW968011:4738443-4738823 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|