Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4224640..4225258 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | LQ149_RS20170 | Protein ID | WP_001291435.1 |
| Coordinates | 4224640..4224858 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | LQ149_RS20175 | Protein ID | WP_000344800.1 |
| Coordinates | 4224884..4225258 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS20130 (4219756) | 4219756..4220067 | - | 312 | WP_000409911.1 | MGMT family protein | - |
| LQ149_RS20140 (4220446) | 4220446..4220799 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| LQ149_RS20145 (4220841) | 4220841..4221107 | - | 267 | Protein_3932 | EAL domain-containing protein | - |
| LQ149_RS20150 (4221163) | 4221163..4221860 | + | 698 | WP_223429336.1 | IS1 family transposase | - |
| LQ149_RS20155 (4221875) | 4221875..4223167 | - | 1293 | Protein_3934 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| LQ149_RS20160 (4223331) | 4223331..4223801 | - | 471 | WP_000136192.1 | YlaC family protein | - |
| LQ149_RS20165 (4223917) | 4223917..4224468 | - | 552 | WP_000102568.1 | maltose O-acetyltransferase | - |
| LQ149_RS20170 (4224640) | 4224640..4224858 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| LQ149_RS20175 (4224884) | 4224884..4225258 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| LQ149_RS20180 (4225804) | 4225804..4228953 | - | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| LQ149_RS20185 (4228976) | 4228976..4230169 | - | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295959 WP_001291435.1 NZ_OW968011:c4224858-4224640 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295959 WP_000344800.1 NZ_OW968011:c4225258-4224884 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |