Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 4189569..4190406 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | Q3Z4X7 |
| Locus tag | LQ149_RS19990 | Protein ID | WP_000227784.1 |
| Coordinates | 4189569..4190111 (-) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | LQ149_RS19995 | Protein ID | WP_001297137.1 |
| Coordinates | 4190095..4190406 (-) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS19970 (4185108) | 4185108..4186019 | - | 912 | WP_000705847.1 | 2-dehydropantoate 2-reductase | - |
| LQ149_RS19975 (4186187) | 4186187..4186678 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| LQ149_RS19980 (4186806) | 4186806..4188170 | - | 1365 | WP_001000978.1 | MFS transporter | - |
| LQ149_RS19985 (4188578) | 4188578..4189513 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
| LQ149_RS19990 (4189569) | 4189569..4190111 | - | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
| LQ149_RS19995 (4190095) | 4190095..4190406 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| LQ149_RS20000 (4190591) | 4190591..4191481 | - | 891 | WP_000971336.1 | heme o synthase | - |
| LQ149_RS20005 (4191493) | 4191493..4191822 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| LQ149_RS20010 (4191822) | 4191822..4192436 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| LQ149_RS20015 (4192426) | 4192426..4194417 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| LQ149_RS20020 (4194439) | 4194439..4195386 | - | 948 | WP_021548571.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T295958 WP_000227784.1 NZ_OW968011:c4190111-4189569 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|