Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2073209..2073863 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | F4NJ21 |
| Locus tag | LQ149_RS09920 | Protein ID | WP_000244772.1 |
| Coordinates | 2073209..2073616 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | LQ149_RS09925 | Protein ID | WP_000354046.1 |
| Coordinates | 2073597..2073863 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS09900 (2069166) | 2069166..2070899 | - | 1734 | WP_000813215.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| LQ149_RS09905 (2070905) | 2070905..2071615 | - | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| LQ149_RS09910 (2071640) | 2071640..2072536 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| LQ149_RS09915 (2072648) | 2072648..2073169 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| LQ149_RS09920 (2073209) | 2073209..2073616 | - | 408 | WP_000244772.1 | protein YgfX | Toxin |
| LQ149_RS09925 (2073597) | 2073597..2073863 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| LQ149_RS09930 (2074106) | 2074106..2075086 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
| LQ149_RS09935 (2075163) | 2075163..2075822 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| LQ149_RS09940 (2075986) | 2075986..2076297 | - | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| LQ149_RS09945 (2076342) | 2076342..2077775 | + | 1434 | WP_001363803.1 | 6-phospho-beta-glucosidase BglA | - |
| LQ149_RS09950 (2077832) | 2077832..2078575 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16048.02 Da Isoelectric Point: 11.2511
>T295950 WP_000244772.1 NZ_OW968011:c2073616-2073209 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWCIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYB4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6B58 | |
| PDB | 1X6I | |
| PDB | 1X6J | |
| PDB | 6C12 | |
| AlphaFold DB | A0A7U9QD57 |