Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1628479..1629104 | Replicon | chromosome |
Accession | NZ_OW968011 | ||
Organism | Escherichia coli isolate 58 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | LQ149_RS07785 | Protein ID | WP_000911330.1 |
Coordinates | 1628479..1628877 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | LQ149_RS07790 | Protein ID | WP_000450524.1 |
Coordinates | 1628877..1629104 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ149_RS07765 (1624357) | 1624357..1624557 | + | 201 | WP_000383836.1 | YpfN family protein | - |
LQ149_RS07770 (1624667) | 1624667..1625365 | - | 699 | WP_000679823.1 | esterase | - |
LQ149_RS07775 (1625439) | 1625439..1627454 | - | 2016 | WP_000829329.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
LQ149_RS07780 (1627469) | 1627469..1628332 | - | 864 | WP_001267508.1 | neutral zinc metallopeptidase | - |
LQ149_RS07785 (1628479) | 1628479..1628877 | - | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
LQ149_RS07790 (1628877) | 1628877..1629104 | - | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
LQ149_RS07795 (1629258) | 1629258..1629971 | - | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
LQ149_RS07800 (1630184) | 1630184..1631218 | - | 1035 | WP_128573118.1 | outer membrane protein assembly factor BamC | - |
LQ149_RS07805 (1631235) | 1631235..1632113 | - | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
LQ149_RS07810 (1632259) | 1632259..1632831 | + | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
LQ149_RS07815 (1632831) | 1632831..1633301 | + | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T295948 WP_000911330.1 NZ_OW968011:c1628877-1628479 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|