Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1131747..1132578 Replicon chromosome
Accession NZ_OW968011
Organism Escherichia coli isolate 58

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag LQ149_RS05530 Protein ID WP_000854814.1
Coordinates 1132204..1132578 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag LQ149_RS05525 Protein ID WP_001285585.1
Coordinates 1131747..1132115 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ149_RS05490 (1126979) 1126979..1128049 + 1071 WP_000102664.1 patatin-like phospholipase family protein -
LQ149_RS05495 (1128185) 1128185..1128868 + 684 WP_023147547.1 hypothetical protein -
LQ149_RS05500 (1128884) 1128884..1129294 + 411 WP_000846713.1 hypothetical protein -
LQ149_RS05505 (1129515) 1129515..1130336 + 822 WP_001234530.1 DUF932 domain-containing protein -
LQ149_RS05510 (1130418) 1130418..1130897 + 480 WP_000860076.1 antirestriction protein -
LQ149_RS05515 (1130913) 1130913..1131389 + 477 WP_001186773.1 RadC family protein -
LQ149_RS05520 (1131452) 1131452..1131673 + 222 WP_000692323.1 DUF987 domain-containing protein -
LQ149_RS05525 (1131747) 1131747..1132115 + 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
LQ149_RS05530 (1132204) 1132204..1132578 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
LQ149_RS05535 (1132575) 1132575..1132769 + 195 WP_000988600.1 DUF5983 family protein -
LQ149_RS05540 (1132815) 1132815..1132895 + 81 Protein_1091 hypothetical protein -
LQ149_RS05545 (1133184) 1133184..1133312 - 129 Protein_1092 transposase domain-containing protein -
LQ149_RS05550 (1133432) 1133432..1133566 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
LQ149_RS05555 (1133667) 1133667..1133996 - 330 WP_000450409.1 DUF496 family protein -
LQ149_RS05560 (1134168) 1134168..1135226 - 1059 WP_029364112.1 FUSC family protein -
LQ149_RS05565 (1135424) 1135424..1135897 - 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
LQ149_RS05570 (1136016) 1136016..1137182 - 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T295946 WP_000854814.1 NZ_OW968011:1132204-1132578 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT295946 WP_001285585.1 NZ_OW968011:1131747-1132115 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References