Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1131747..1132578 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | LQ149_RS05530 | Protein ID | WP_000854814.1 |
| Coordinates | 1132204..1132578 (+) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B3Y195 |
| Locus tag | LQ149_RS05525 | Protein ID | WP_001285585.1 |
| Coordinates | 1131747..1132115 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS05490 (1126979) | 1126979..1128049 | + | 1071 | WP_000102664.1 | patatin-like phospholipase family protein | - |
| LQ149_RS05495 (1128185) | 1128185..1128868 | + | 684 | WP_023147547.1 | hypothetical protein | - |
| LQ149_RS05500 (1128884) | 1128884..1129294 | + | 411 | WP_000846713.1 | hypothetical protein | - |
| LQ149_RS05505 (1129515) | 1129515..1130336 | + | 822 | WP_001234530.1 | DUF932 domain-containing protein | - |
| LQ149_RS05510 (1130418) | 1130418..1130897 | + | 480 | WP_000860076.1 | antirestriction protein | - |
| LQ149_RS05515 (1130913) | 1130913..1131389 | + | 477 | WP_001186773.1 | RadC family protein | - |
| LQ149_RS05520 (1131452) | 1131452..1131673 | + | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| LQ149_RS05525 (1131747) | 1131747..1132115 | + | 369 | WP_001285585.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| LQ149_RS05530 (1132204) | 1132204..1132578 | + | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| LQ149_RS05535 (1132575) | 1132575..1132769 | + | 195 | WP_000988600.1 | DUF5983 family protein | - |
| LQ149_RS05540 (1132815) | 1132815..1132895 | + | 81 | Protein_1091 | hypothetical protein | - |
| LQ149_RS05545 (1133184) | 1133184..1133312 | - | 129 | Protein_1092 | transposase domain-containing protein | - |
| LQ149_RS05550 (1133432) | 1133432..1133566 | + | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| LQ149_RS05555 (1133667) | 1133667..1133996 | - | 330 | WP_000450409.1 | DUF496 family protein | - |
| LQ149_RS05560 (1134168) | 1134168..1135226 | - | 1059 | WP_029364112.1 | FUSC family protein | - |
| LQ149_RS05565 (1135424) | 1135424..1135897 | - | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| LQ149_RS05570 (1136016) | 1136016..1137182 | - | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T295946 WP_000854814.1 NZ_OW968011:1132204-1132578 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13593.48 Da Isoelectric Point: 6.3139
>AT295946 WP_001285585.1 NZ_OW968011:1131747-1132115 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LW60 |