Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 529397..530035 | Replicon | chromosome |
| Accession | NZ_OW968011 | ||
| Organism | Escherichia coli isolate 58 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | LQ149_RS02620 | Protein ID | WP_000813794.1 |
| Coordinates | 529397..529573 (+) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | LQ149_RS02625 | Protein ID | WP_001270286.1 |
| Coordinates | 529619..530035 (+) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ149_RS02600 (525016) | 525016..526191 | - | 1176 | WP_001236319.1 | BenE family transporter YdcO | - |
| LQ149_RS02605 (526283) | 526283..526819 | + | 537 | WP_000429141.1 | DNA-binding transcriptional regulator SutR | - |
| LQ149_RS02610 (526892) | 526892..528853 | + | 1962 | WP_001307191.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| LQ149_RS02615 (528945) | 528945..529175 | - | 231 | WP_000494244.1 | YncJ family protein | - |
| LQ149_RS02620 (529397) | 529397..529573 | + | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| LQ149_RS02625 (529619) | 529619..530035 | + | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| LQ149_RS02630 (530114) | 530114..531520 | + | 1407 | WP_000760629.1 | PLP-dependent aminotransferase family protein | - |
| LQ149_RS02635 (531765) | 531765..532910 | + | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| LQ149_RS02640 (532928) | 532928..533295 | + | 368 | Protein_522 | ABC transporter ATP-binding protein | - |
| LQ149_RS02645 (533351) | 533351..534048 | + | 698 | WP_223429336.1 | IS1 family transposase | - |
| LQ149_RS02650 (534064) | 534064..534717 | + | 654 | Protein_524 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 523711..524976 | 1265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T295940 WP_000813794.1 NZ_OW968011:529397-529573 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT295940 WP_001270286.1 NZ_OW968011:529619-530035 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|