Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 6640..7162 Replicon plasmid P4
Accession NZ_OW967979
Organism Escherichia coli isolate 10

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag LQ150_RS25220 Protein ID WP_000220561.1
Coordinates 6640..6921 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag LQ150_RS25225 Protein ID WP_000121743.1
Coordinates 6911..7162 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ150_RS25175 (AI2852V1_4864) 1907..2254 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
LQ150_RS25180 (AI2852V1_4865) 2251..2499 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
LQ150_RS25185 (AI2852V1_4867) 2804..3154 - 351 WP_000854260.1 hypothetical protein -
LQ150_RS25190 (AI2852V1_4868) 3249..3548 - 300 WP_000650310.1 hypothetical protein -
LQ150_RS25195 (AI2852V1_4869) 4002..4229 - 228 WP_000801440.1 hypothetical protein -
LQ150_RS25200 (AI2852V1_4870) 4216..4467 - 252 WP_001230707.1 hypothetical protein -
LQ150_RS25205 (AI2852V1_4871) 4464..5006 - 543 WP_001083906.1 hypothetical protein -
LQ150_RS25210 (AI2852V1_4872) 5111..5626 - 516 WP_001025397.1 J domain-containing protein -
LQ150_RS25215 (AI2852V1_4873) 6266..6616 - 351 WP_000312755.1 hypothetical protein -
LQ150_RS25220 (AI2852V1_4874) 6640..6921 - 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
LQ150_RS25225 (AI2852V1_4875) 6911..7162 - 252 WP_000121743.1 plasmid stabilization protein Antitoxin
LQ150_RS25230 (AI2852V1_4877) 8528..9535 + 1008 WP_000243325.1 replication initiation protein -
LQ150_RS25235 (AI2852V1_4878) 9601..10005 + 405 WP_000654312.1 hypothetical protein -
LQ150_RS25240 (AI2852V1_4879) 10141..10668 + 528 WP_000577047.1 DUF2726 domain-containing protein -
LQ150_RS25245 (AI2852V1_4882) 11240..11491 - 252 WP_000905714.1 hypothetical protein -
LQ150_RS25250 (AI2852V1_4883) 11528..11830 - 303 WP_001096506.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..35225 35225


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T295934 WP_000220561.1 NZ_OW967979:c6921-6640 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT295934 WP_000121743.1 NZ_OW967979:c7162-6911 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References