Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 4002..4467 Replicon plasmid P4
Accession NZ_OW967979
Organism Escherichia coli isolate 10

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag LQ150_RS25200 Protein ID WP_001230707.1
Coordinates 4216..4467 (-) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag LQ150_RS25195 Protein ID WP_000801440.1
Coordinates 4002..4229 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ150_RS25170 (AI2852V1_4863) 1040..1543 - 504 WP_000781817.1 DNA distortion polypeptide 1 -
LQ150_RS25175 (AI2852V1_4864) 1907..2254 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
LQ150_RS25180 (AI2852V1_4865) 2251..2499 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
LQ150_RS25185 (AI2852V1_4867) 2804..3154 - 351 WP_000854260.1 hypothetical protein -
LQ150_RS25190 (AI2852V1_4868) 3249..3548 - 300 WP_000650310.1 hypothetical protein -
LQ150_RS25195 (AI2852V1_4869) 4002..4229 - 228 WP_000801440.1 hypothetical protein Antitoxin
LQ150_RS25200 (AI2852V1_4870) 4216..4467 - 252 WP_001230707.1 hypothetical protein Toxin
LQ150_RS25205 (AI2852V1_4871) 4464..5006 - 543 WP_001083906.1 hypothetical protein -
LQ150_RS25210 (AI2852V1_4872) 5111..5626 - 516 WP_001025397.1 J domain-containing protein -
LQ150_RS25215 (AI2852V1_4873) 6266..6616 - 351 WP_000312755.1 hypothetical protein -
LQ150_RS25220 (AI2852V1_4874) 6640..6921 - 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin -
LQ150_RS25225 (AI2852V1_4875) 6911..7162 - 252 WP_000121743.1 plasmid stabilization protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..35225 35225


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T295933 WP_001230707.1 NZ_OW967979:c4467-4216 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT295933 WP_000801440.1 NZ_OW967979:c4229-4002 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References