Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 78273..78898 Replicon plasmid P1
Accession NZ_OW967976
Organism Escherichia coli isolate 10

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag LQ150_RS24000 Protein ID WP_000911313.1
Coordinates 78500..78898 (+) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID V0VCB2
Locus tag LQ150_RS23995 Protein ID WP_000450520.1
Coordinates 78273..78500 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ150_RS23995 (78273) 78273..78500 + 228 WP_000450520.1 toxin-antitoxin system antitoxin VapB Antitoxin
LQ150_RS24000 (78500) 78500..78898 + 399 WP_000911313.1 type II toxin-antitoxin system VapC family toxin Toxin
LQ150_RS24005 (78907) 78907..79044 - 138 WP_230163687.1 hypothetical protein -
LQ150_RS24010 (79111) 79111..79815 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
LQ150_RS24015 (79880) 79880..80122 - 243 Protein_82 DUF932 domain-containing protein -
LQ150_RS24020 (80240) 80240..80527 - 288 WP_000107535.1 hypothetical protein -
LQ150_RS24025 (80552) 80552..80758 - 207 WP_000547968.1 hypothetical protein -
LQ150_RS24030 (80828) 80828..81000 + 173 Protein_85 hypothetical protein -
LQ150_RS24035 (80998) 80998..81228 - 231 WP_071586998.1 hypothetical protein -
LQ150_RS24040 (81448) 81448..81573 - 126 WP_001372321.1 type I toxin-antitoxin system Hok family toxin -
LQ150_RS24045 (81515) 81515..81664 - 150 Protein_88 plasmid maintenance protein Mok -
- (81650) 81650..81874 - 225 NuclAT_0 - -
- (81650) 81650..81874 - 225 NuclAT_0 - -
- (81650) 81650..81874 - 225 NuclAT_0 - -
- (81650) 81650..81874 - 225 NuclAT_0 - -
LQ150_RS24050 (81686) 81686..81874 + 189 WP_001299721.1 hypothetical protein -
LQ150_RS24055 (81843) 81843..82605 - 763 Protein_90 plasmid SOS inhibition protein A -
LQ150_RS24060 (82602) 82602..83036 - 435 WP_000845936.1 conjugation system SOS inhibitor PsiB -
LQ150_RS24065 (83091) 83091..83288 - 198 Protein_92 hypothetical protein -
LQ150_RS24070 (83316) 83316..83549 - 234 WP_000005987.1 DUF905 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..106879 106879


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(8-50)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14901.15 Da        Isoelectric Point: 7.8605

>T295924 WP_000911313.1 NZ_OW967976:78500-78898 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8596.63 Da        Isoelectric Point: 4.7513

>AT295924 WP_000450520.1 NZ_OW967976:78273-78500 [Escherichia coli]
METTVFFSNRSQAVRLPKAVALPENVKRVEVIAVGRTRIITPAGETWDEWFDGHNVSADFMDNREQPGMQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB V0VCB2

References