Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4206413..4207248 | Replicon | chromosome |
| Accession | NZ_OW967975 | ||
| Organism | Escherichia coli isolate 10 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | LQ150_RS20440 | Protein ID | WP_000854759.1 |
| Coordinates | 4206413..4206790 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | LQ150_RS20445 | Protein ID | WP_001295723.1 |
| Coordinates | 4206880..4207248 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LQ150_RS20410 (4202041) | 4202041..4202787 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| LQ150_RS20415 (4202802) | 4202802..4204343 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| LQ150_RS20420 (4204937) | 4204937..4205113 | - | 177 | Protein_4016 | helix-turn-helix domain-containing protein | - |
| LQ150_RS20425 (4205480) | 4205480..4205629 | - | 150 | Protein_4017 | hypothetical protein | - |
| LQ150_RS20430 (4205735) | 4205735..4205911 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| LQ150_RS20435 (4205928) | 4205928..4206416 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| LQ150_RS20440 (4206413) | 4206413..4206790 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| LQ150_RS20445 (4206880) | 4206880..4207248 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| LQ150_RS20450 (4207411) | 4207411..4207632 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| LQ150_RS20455 (4207695) | 4207695..4208171 | - | 477 | WP_001186775.1 | RadC family protein | - |
| LQ150_RS20460 (4208187) | 4208187..4208660 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| LQ150_RS20465 (4209002) | 4209002..4209820 | - | 819 | WP_001234652.1 | DUF932 domain-containing protein | - |
| LQ150_RS20470 (4209938) | 4209938..4210133 | - | 196 | Protein_4026 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4193606..4225781 | 32175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T295918 WP_000854759.1 NZ_OW967975:c4206790-4206413 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT295918 WP_001295723.1 NZ_OW967975:c4207248-4206880 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |