Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3537768..3538386 | Replicon | chromosome |
Accession | NZ_OW967975 | ||
Organism | Escherichia coli isolate 10 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | LQ150_RS17180 | Protein ID | WP_001291435.1 |
Coordinates | 3538168..3538386 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | LQ150_RS17175 | Protein ID | WP_000344800.1 |
Coordinates | 3537768..3538142 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ150_RS17165 (3532857) | 3532857..3534050 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
LQ150_RS17170 (3534073) | 3534073..3537222 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
LQ150_RS17175 (3537768) | 3537768..3538142 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
LQ150_RS17180 (3538168) | 3538168..3538386 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
LQ150_RS17185 (3538558) | 3538558..3539109 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
LQ150_RS17190 (3539225) | 3539225..3539695 | + | 471 | WP_000136192.1 | YlaC family protein | - |
LQ150_RS17195 (3539859) | 3539859..3541409 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
LQ150_RS17200 (3541451) | 3541451..3541804 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
LQ150_RS17210 (3542183) | 3542183..3542494 | + | 312 | WP_000409911.1 | MGMT family protein | - |
LQ150_RS17215 (3542525) | 3542525..3543097 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T295914 WP_001291435.1 NZ_OW967975:3538168-3538386 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT295914 WP_000344800.1 NZ_OW967975:3537768-3538142 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |