Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 999702..1000285 | Replicon | chromosome |
Accession | NZ_OW967975 | ||
Organism | Escherichia coli isolate 10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | LQ150_RS04830 | Protein ID | WP_000254738.1 |
Coordinates | 999950..1000285 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | LQ150_RS04825 | Protein ID | WP_000581937.1 |
Coordinates | 999702..999950 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LQ150_RS04815 (996041) | 996041..997342 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
LQ150_RS04820 (997390) | 997390..999624 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
LQ150_RS04825 (999702) | 999702..999950 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
LQ150_RS04830 (999950) | 999950..1000285 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
LQ150_RS04835 (1000356) | 1000356..1001147 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
LQ150_RS04840 (1001375) | 1001375..1003012 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
LQ150_RS04845 (1003100) | 1003100..1004398 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T295905 WP_000254738.1 NZ_OW967975:999950-1000285 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|